DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CROT and crot

DIOPT Version :9

Sequence 1:NP_001334704.1 Gene:CROT / 43332 FlyBaseID:FBgn0039543 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_001128278.1 Gene:crot / 733879 XenbaseID:XB-GENE-988067 Length:481 Species:Xenopus tropicalis


Alignment Length:476 Identity:147/476 - (30%)
Similarity:252/476 - (52%) Gaps:35/476 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DKNTFDFDETLPSLPLPELRDTMERYYSCIQPFGTKEELAQARKTIDEFQNGVGAQLHEQLKKRA 77
            ::.||.:.::||.||:|.|.:::.:|...::||..:||..:..:.:..|:||:|.:||::|.:||
 Frog    10 EERTFQYQDSLPPLPVPSLAESLSKYCDAVKPFLNQEEYERTCQIVKAFENGIGKELHQKLLQRA 74

  Fly    78 AGMRNWLGTWWEDYGYHLIRMPL---------LPYQLMVMPSQLEMVGVPETPEYMLKSLARHIH 133
            ...:|||..||.:..|..:|||.         .||.....|::       :..:....|:|  :.
 Frog    75 RFKKNWLEEWWLNAAYLDVRMPSQLNVNFGGPAPYLEHYWPAE-------KGTQLQRASIA--VW 130

  Fly   134 HSLEFWDLTRKSSIKPLSSNGGKIKYSSALYKHFFSTCRVPGEEQDHIEKHFLTKDEGKTPSHML 198
            ::|::|:|.|:..:....:....:..|.  :::.|:||::||..:|.|...|.|:.||..|:|:.
 Frog   131 YTLKYWELIRREKLGVHKAVNYPLDMSQ--FRNLFNTCKIPGRTRDIISSRFKTESEGSCPTHLA 193

  Fly   199 ISGKGRQFIFDCVHEDDTILSAPEILVALQRVRSILDYEPLGDCVPTLSHDERSTWARNRNRLRE 263
            :..:||.|.||.|.|.. ||:.||:|..||.::.|...||.|..:..|:.:||:.||:.|..|..
 Frog   194 VMARGRIFTFDAVPEGQ-ILTPPELLRQLQYIQDICQTEPAGIGLSALTTEERTRWAQIREHLIS 257

  Fly   264 ISVANKETLLLVESACMEICWYEQS----PKDYEESCQLGLYGDLHSRWADRSSSIIAFRNGRCN 324
            :...|...|..::|:...:.....|    |:||.:...:.|.||...||.|:|.::||:.||...
 Frog   258 LDPMNSTHLEDIQSSLFILSLDSASPYGTPEDYSQIAMMALAGDPTVRWGDKSYNLIAWSNGVFG 322

  Fly   325 WTGEHSCYDGTVSISYATFMQLSFLEVPEPDWAEAEKGN--VLEV---KELHFQLDDTLKNEIKR 384
            ...:|:.||..|.::...::..: ::..|..|    ||:  |.|:   |||.|.:|..:..:|..
 Frog   323 SNCDHAPYDAMVLVAMCDYIDQN-VKACEGRW----KGSAAVRELPNPKELVFTVDQKILKDIAI 382

  Fly   385 VQKDIDDRGIDVTVTFTAFDDYGKDFMKTHRLHPDSFVQVVMQWAYYQMHKEIAPTYETALMRQY 449
            .::....:..|:.:...||..:||..:|..:||||:|||:.:|.|||::|......||||..|.:
 Frog   383 AKEQYYKQASDLQIVNYAFTSFGKQLVKKKKLHPDTFVQLALQLAYYKIHGCPGCCYETATTRMF 447

  Fly   450 YNGRTETLRSCTSAVAEFLRA 470
            |:|||||:|.||...|.:.|:
 Frog   448 YHGRTETMRPCTVEAATWCRS 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CROTNP_001334704.1 None
crotNP_001128278.1 Carn_acyltransf 20..>475 CDD:279140 145/466 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 328 1.000 Domainoid score I1174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H10899
Inparanoid 1 1.050 337 1.000 Inparanoid score I2345
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D167256at33208
OrthoFinder 1 1.000 - - FOG0006330
OrthoInspector 1 1.000 - - oto103066
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4606
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.