DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ALiX and Rhpn1

DIOPT Version :9

Sequence 1:NP_651582.1 Gene:ALiX / 43330 FlyBaseID:FBgn0086346 Length:836 Species:Drosophila melanogaster
Sequence 2:XP_006520510.1 Gene:Rhpn1 / 14787 MGIID:1098783 Length:662 Species:Mus musculus


Alignment Length:281 Identity:82/281 - (29%)
Similarity:125/281 - (44%) Gaps:29/281 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LKKPSEVDVIKPLNNLIQSTYNGASEEEKGKYGEAVNEFSKQRNTAIWKFFEKYEASLEIVYAYY 73
            ||:..|:|...||..||...:.    |:...:...:.|....|...  :...:.||.|:::.|||
Mouse   121 LKETKELDWATPLKELISEHFG----EDGTSFETEIQELEDLRQAT--RTPSRDEAGLDLLAAYY 179

  Fly    74 DQICALETKISVSELQIP---FKWKDAFDKGSIFGGKISLTHTSLLYEKVCVLFNIAALQSNIAA 135
            .|:|.|:.:. .|..:.|   |.|.|     |:.|  :.....:|.:||..|||||.||.:.|.|
Mouse   180 SQLCFLDARF-FSPSRSPGLLFHWYD-----SLTG--VPAQQRALAFEKGSVLFNIGALHTQIGA 236

  Fly   136 NQSLDSDDGLKLTIKLLQQSAGIFQYLKGATPAAVPSEPTPDLSQDTLTVLQALMVAQAQEVFI- 199
            .|.....:|.....:..|::||.|:.|:.....|    |:||:|..:|::|:.||:|||||... 
Mouse   237 RQDCSCTEGTNHAAEAFQRAAGAFRLLRENFSHA----PSPDMSAASLSMLEQLMIAQAQECIFK 297

  Fly   200 -----LKAIKDNLKDQI-IAKLCCQAEESYADVLRAMQKESVRSLWEKEWIPTIAGKQAGFHALT 258
                 ..|..|...||: :|:...|....|..|.|||.:..||......|......|...|.||.
Mouse   298 GLLLPASATPDICPDQLQLAQEAAQVATEYGLVHRAMAQPPVRDYLPASWTNLAHVKAEHFCALA 362

  Fly   259 QLYQSL-VCRAAKKIGEEIAR 278
            ..:.:: :|.:......|:||
Mouse   363 HYHAAMALCESHPAAKGELAR 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ALiXNP_651582.1 BRO1_Alix 2..347 CDD:185763 82/281 (29%)
V_Alix 362..698 CDD:185748
ALIX_LYPXL_bnd 415..701 CDD:290660
MFMR 733..822 CDD:285072
Rhpn1XP_006520510.1 HR1_Rhophilin-1 28..112 CDD:212023
BRO1_Rhophilin_1 116..499 CDD:185771 82/281 (29%)
PDZ_signaling 520..594 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2220
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.