DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPBAP1 and AT5G19840

DIOPT Version :9

Sequence 1:NP_651581.2 Gene:HSPBAP1 / 43329 FlyBaseID:FBgn0263025 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001190341.1 Gene:AT5G19840 / 832104 AraportID:AT5G19840 Length:549 Species:Arabidopsis thaliana


Alignment Length:321 Identity:76/321 - (23%)
Similarity:131/321 - (40%) Gaps:68/321 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KSSQLLNM-------QQFLRKYGVLDGDSTHWAAYQYKKADEVPLS-CRSGIGFSSFGFPDIGND 126
            ||:.|..|       |.:|.::.:|:.:          |.::|.|. .|..|...:|......:.
plant   115 KSADLNPMCEDYRPGQIYLAQFPILNDE----------KEEKVLLKILRQDIQTPTFLDAKSLSS 169

  Fly   127 YRFWLGSEQANTPCHYDTFGVNIVVQVHGCKSWLLFPPETPLQSTRIP-YEETSVYC---LENFY 187
            ..||:.|.:|.:..|||... |::..|.|.|..:|:||........:| |.|.|.:.   |||  
plant   170 INFWMNSAEARSSTHYDPHH-NLLCVVSGRKKVVLWPPSASPSLYPMPIYGEASNHSSVGLEN-- 231

  Fly   188 APDPAKISSYEHLGRQAYHCNLQPGNVLIVPRHWWHYVEAKSTSLSVNYWVPLKV--DMDLILDE 250
             |:.:.....||..:|:....|..|:.:.:|..|:|.|::...:::||:|.....  :|...:|.
plant   232 -PNLSDYPRAEHSLKQSQEITLNAGDAVFIPEGWFHQVDSDELTVAVNFWWQSNYMSNMPEHMDS 295

  Fly   251 FLVMHIVESF---------VRGESNQVKQYLLNPNQ--LDNVSTKPSDLFAQFEQAVQNLESGKS 304
            :.:..|..|.         :|..|..:.|..:...:  .||:..             ::::.|.|
plant   296 YYLRRITRSLLVSKPSSTDLRHLSEHIDQSRIEMAEGGNDNIGN-------------ESIKKGLS 347

  Fly   305 T----RQLYDTD-YISQA--DWKTL----LNSINLSVRPLEVMPH-----EEYKLLLNANS 349
            |    ..|:|.| ..|||  |..:|    :|:::.|.......|.     |:.|.|:||.|
plant   348 TLHEKASLHDLDPSASQALHDLISLVHDHVNAVDTSKGLQHTSPSCSEGGEKSKFLVNAMS 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPBAP1NP_651581.2 cupin_like 11..237 CDD:304367 46/178 (26%)
AT5G19840NP_001190341.1 Cupin_8 19..285 CDD:290351 47/183 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.