DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPBAP1 and JMJD5

DIOPT Version :9

Sequence 1:NP_651581.2 Gene:HSPBAP1 / 43329 FlyBaseID:FBgn0263025 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_850617.1 Gene:JMJD5 / 821629 AraportID:AT3G20810 Length:429 Species:Arabidopsis thaliana


Alignment Length:305 Identity:73/305 - (23%)
Similarity:104/305 - (34%) Gaps:118/305 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SKLRDLILNTHVPLVLEQFPLKWECFEGSLHDWCKRFDKEATCLPAFELMALADSSTPQWERKRT 69
            :::|.::.|..: |||:..|.:      ||  .|||.:|.:.                       
plant   161 NEVRHVLANLQL-LVLKILPCR------SL--TCKRVEKRSG----------------------- 193

  Fly    70 KSSQLLNMQQFLRKY------GVLDGDSTHWAA------YQYKKA----DEVPLSCRSG------ 112
                 |:::.|||.|      .|:.....||.|      ..|..|    ..||:.....      
plant   194 -----LSLEGFLRDYYLPGTPVVITNSMAHWPARTKWNHLDYLNAVAGNRTVPVEVGKNYLCSDW 253

  Fly   113 ----IGFSSF---------------------GFPDIGN--------DYRF-----------WLGS 133
                :.||.|                     .|..|..        ||.|           |.|.
plant   254 KQELVTFSKFLERMRTNKSSPMEPTYLAQHPLFDQINELRDDICIPDYCFVGGGELQSLNAWFGP 318

  Fly   134 EQANTPCHYDTFGVNIVVQVHGCKSWLLFPPETPLQSTRIPYEETSVYC------LENFYAPDPA 192
            ....||.|:|... ||:.||.|.|...|:|  :.||....||.|| :.|      |:|....:..
plant   319 AGTVTPLHHDPHH-NILAQVVGKKYIRLYP--SFLQDELYPYSET-MLCNSSQVDLDNIDETEFP 379

  Fly   193 KISSYEHLGRQAYHCNLQPGNVLIVPRHWWHYVEAKSTSLSVNYW 237
            |....|.:     .|.|:.|.:|.:|..|||||.:.:.||||::|
plant   380 KAMELEFM-----DCILEEGEMLYIPPKWWHYVRSLTMSLSVSFW 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPBAP1NP_651581.2 cupin_like 11..237 CDD:304367 71/297 (24%)
JMJD5NP_850617.1 Cupin_8 199..423 CDD:290351 60/230 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.