DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPBAP1 and Kdm8

DIOPT Version :9

Sequence 1:NP_651581.2 Gene:HSPBAP1 / 43329 FlyBaseID:FBgn0263025 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_084118.1 Gene:Kdm8 / 77035 MGIID:1924285 Length:414 Species:Mus musculus


Alignment Length:236 Identity:58/236 - (24%)
Similarity:97/236 - (41%) Gaps:41/236 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PLVLEQFPLKWECFEGSLHDWCKRFDKEATCLPAFELMALADSSTPQWERKRTKSSQLLNMQQFL 81
            |::||.....|.|    :..|..::.:|........:...:..:...|      |..|:.:.:|:
Mouse   203 PVILEGVADHWPC----MKKWSLQYIQEIAGCRTVPVEVGSRYTDEDW------SQTLMTVDEFI 257

  Fly    82 RKYGVLDGDSTHWAAYQYKKADEVPLSCRSGIGFSSFGFPD---IGN------DYRFWLGSEQAN 137
            :|:.:.:.....:.| |::..|::|...|      ....||   :||      ....|.|.:...
Mouse   258 QKFILSEAKDVGYLA-QHQLFDQIPELKR------DISIPDYCCLGNGEEEEITINAWFGPQGTI 315

  Fly   138 TPCHYDTFGVNIVVQVHGCKSWLLFPPETPLQSTRI-PYE-----ETSVYCLENFYAPDPAKISS 196
            :|.|.|. ..|.:|||.|.|...|:.|:   :|..: |:|     .||...:||   ||..|...
Mouse   316 SPLHQDP-QQNFLVQVLGRKYIRLYSPQ---ESEAVYPHETHILHNTSQVDVEN---PDLEKFPK 373

  Fly   197 YEHLGRQAYHCNLQPGNVLIVPRHWWHYVEAKSTSLSVNYW 237
            :..  .....|.|.||:.|.:|..:||||.:...|.||::|
Mouse   374 FTE--APFLSCILSPGDTLFIPAKYWHYVRSLDLSFSVSFW 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPBAP1NP_651581.2 cupin_like 11..237 CDD:304367 57/234 (24%)
Kdm8NP_084118.1 Interaction with RCCD1. /evidence=ECO:0000250|UniProtKB:Q8N371 1..107
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 148..169
Cupin_8 189..414 CDD:290351 58/236 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.