DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPBAP1 and Tyw5

DIOPT Version :9

Sequence 1:NP_651581.2 Gene:HSPBAP1 / 43329 FlyBaseID:FBgn0263025 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001289891.1 Gene:Tyw5 / 68736 MGIID:1915986 Length:317 Species:Mus musculus


Alignment Length:244 Identity:60/244 - (24%)
Similarity:94/244 - (38%) Gaps:43/244 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PLVLEQFPL-----KWECFEGSLHDWCKRFDKEATCLPAFEL--MALADSSTPQWERKRTKSSQL 74
            |||||...|     ||.....|.....|........:|..:.  :.|..|.:.:..:|..|:|..
Mouse    29 PLVLEGLDLGSCTSKWTVDYLSQVGGTKEVKIHVAAVPQMDFIKLYLLTSWSREQPKKHIKNSSF 93

  Fly    75 LNMQQFLRKYGVLD-GDSTHWAAYQYKKADEVPLSCRSGIGFSSFGFPDIGNDYRF--WLGSEQ- 135
            ..|:.  ..||.|: ...:...::..|...::...           ||.:|.|..|  :...|| 
Mouse    94 QRMRN--TTYGHLEKTQGSRKNSFTGKDVADIRQQ-----------FPSLGGDITFPMFFREEQF 145

  Fly   136 ------ANTP-----CHYDTFGVNIVVQVHGCKSWLLFPPETPLQSTRIPYEETSVYCLENFYAP 189
                  .::|     .|||... |.::||.|.|...||.|    :..:..|...|...:.|..:|
Mouse   146 FSSVFRISSPGLQLWTHYDVMD-NFLIQVTGKKRITLFNP----RDAQYLYLSGSKSEVLNIDSP 205

  Fly   190 DPAKISSYEHLGRQAYHCNLQPGNVLIVPRHWWHYVEAKSTSLSVN-YW 237
            |..|...:....|  |.|:|:.|:||.:|..|:|.|.::...:.|| :|
Mouse   206 DLDKYPLFPKARR--YECSLEAGDVLFIPALWFHNVVSEEFGVGVNIFW 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPBAP1NP_651581.2 cupin_like 11..237 CDD:304367 59/242 (24%)
Tyw5NP_001289891.1 Cupin_8 17..257 CDD:290351 60/244 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.