DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPBAP1 and Hspbap1

DIOPT Version :9

Sequence 1:NP_651581.2 Gene:HSPBAP1 / 43329 FlyBaseID:FBgn0263025 Length:398 Species:Drosophila melanogaster
Sequence 2:XP_006522532.1 Gene:Hspbap1 / 66667 MGIID:1913917 Length:507 Species:Mus musculus


Alignment Length:323 Identity:98/323 - (30%)
Similarity:141/323 - (43%) Gaps:59/323 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KLRDLILNTHVPLVLEQFPLKWECFEGSLHDWCKRFDKEATCLPAFELMALADSST-PQWERKRT 69
            |.:::|::...|.:.......|.    |.|...|...|..........|.|..:.| ||:|   |
Mouse    32 KAKEIIMSLQQPAIFCNMVFDWP----SRHWTAKHLSKVLEGKQIRFRMGLRGTGTVPQYE---T 89

  Fly    70 KSSQL-LNMQQFLR---KYGVLDG---DSTH---WAAYQYK--------KADEVPLSCRSGIGFS 116
            :.|.: ..:::||.   ....:.|   |..|   ||...||        |.|..    :..:.:|
Mouse    90 ECSYVDATLEEFLTWNCDQSSISGPFKDYEHSKFWAYADYKYFVTLFEDKTDVF----QQEVVWS 150

  Fly   117 SFGFPD-IGNDYRFWLGSEQANTPCHYDTFGVNIVVQ-----------------VHGC------K 157
            .||||. .|.:...|:||..|:||||.|::|.|:|.|                 |..|      |
Mouse   151 DFGFPGRNGQESTLWIGSFGAHTPCHLDSYGCNLVFQRTEKFVETQRLHCGPLDVDRCQEAWIRK 215

  Fly   158 SWLLFPPE-TP-LQSTRIPYEETSVYCLENFYAPDPAKISSYEHLGRQAYHCNLQPGNVLIVPRH 220
            .|.||||| || |..|||||||:||:...|...||......::...|  :...|.||.||.||||
Mouse   216 RWHLFPPEDTPFLYPTRIPYEESSVFSKINVVNPDLKCFPQFQKARR--HMVTLSPGQVLFVPRH 278

  Fly   221 WWHYVEA-KSTSLSVNYWVPLKVDMDLILDEFLVMHIVESFVRGESNQVKQYLLNPNQLDNVS 282
            ||||||: ...::|:|.|:.|:.|....::|.:...:|.:....|.....:..|||.:::..|
Mouse   279 WWHYVESLDPVTVSINSWIELEEDHLARVEEAITRMLVCTLKTAEDPHHPRTWLNPTEVEETS 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPBAP1NP_651581.2 cupin_like 11..237 CDD:304367 87/271 (32%)
Hspbap1XP_006522532.1 Cupin_8 37..296 CDD:372651 87/271 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834609
Domainoid 1 1.000 116 1.000 Domainoid score I5996
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385616at2759
OrthoFinder 1 1.000 - - FOG0008275
OrthoInspector 1 1.000 - - oto92533
orthoMCL 1 0.900 - - OOG6_109247
Panther 1 1.100 - - LDO PTHR12461
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6086
SonicParanoid 1 1.000 - - X6251
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.880

Return to query results.
Submit another query.