DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPBAP1 and tyw5

DIOPT Version :9

Sequence 1:NP_651581.2 Gene:HSPBAP1 / 43329 FlyBaseID:FBgn0263025 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001071011.1 Gene:tyw5 / 557725 ZFINID:ZDB-GENE-060929-894 Length:326 Species:Danio rerio


Alignment Length:273 Identity:61/273 - (22%)
Similarity:103/273 - (37%) Gaps:84/273 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LRDLILNTHVPLVLEQFPL-----KWE-CFEGSLHDWCKRFDKEA-------------------T 46
            ||| |.....|.||::.|:     .|. ||...     |..|:|.                   .
Zfish    21 LRD-IYPQRRPAVLKRVPIGPCVRTWTVCFLAE-----KGGDREVKVHVSPEPRMDFLHKNFVYR 79

  Fly    47 CLPAFE-LMALADSSTPQWERKRTKSSQLLNMQQFLRKYGVLDGDSTHWAAYQYKKADEVPLSCR 110
            .||..| :...|::..|::.....:|       .:||..|              :.|.:.|...|
Zfish    80 TLPFDEFIKRAAEAKHPEFFISEDES-------YYLRSLG--------------EDARKEPADLR 123

  Fly   111 SGIGFSSFGFPDIGNDY---------RFWLGSEQANTP-----CHYDTFGVNIVVQVHGCKSWLL 161
            .       .||::..|:         :|:....:.::|     .|||... |::.||.|.|..:|
Zfish   124 K-------QFPELAEDFHVPQFFEPEQFFSSVFRISSPGLQLWTHYDVMD-NLLAQVTGKKRVVL 180

  Fly   162 FPPETPLQSTRIPYEETSVYCLENFYAPDPAKISSY-EHLGRQAYHCNLQPGNVLIVPRHWWHYV 225
            :.||..|. ..:..:::.|..::   :||   :..| |.:..:.|.|.|:||::|.:|..|:|..
Zfish   181 YSPEDALH-LYLTGDKSEVLDID---SPD---LQLYPEFVKARRYECILEPGDLLFIPALWFHNT 238

  Fly   226 EAKSTSLSVN-YW 237
            .|....:.|| :|
Zfish   239 LALQFGVGVNVFW 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPBAP1NP_651581.2 cupin_like 11..237 CDD:304367 57/267 (21%)
tyw5NP_001071011.1 Cupin_8 18..256 CDD:290351 61/273 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.