DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPBAP1 and kdm8

DIOPT Version :9

Sequence 1:NP_651581.2 Gene:HSPBAP1 / 43329 FlyBaseID:FBgn0263025 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001103339.2 Gene:kdm8 / 436936 ZFINID:ZDB-GENE-040718-411 Length:406 Species:Danio rerio


Alignment Length:244 Identity:60/244 - (24%)
Similarity:99/244 - (40%) Gaps:32/244 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KLRDLILNTHVPLVLEQFPLKWECFEGSLHDWCKRFDKEATCLPAFELMALADSSTPQWERKRTK 70
            :.|...|::..|:::|.....|..|  :.|.|...:.:.........:...:..:..:|.:|   
Zfish   181 RFRSDFLDSKKPVIIEGITDHWPAF--TQHPWSIDYLRTVAGCRTVPIEVGSKYTDEEWSQK--- 240

  Fly    71 SSQLLNMQQFLRKYGVLDGDSTHWAAY--QYKKADEVPLSCRSGIGFSSFGFPDIGND----YRF 129
               |:.:..|:.:|  :.|.......|  |::..|:|| ..:..|....:.....|::    ...
Zfish   241 ---LITVNDFIDRY--ITGTEEDGVGYLAQHQLFDQVP-ELKEDIRIPDYCCLGEGDEDDITINA 299

  Fly   130 WLGSEQANTPCHYDTFGVNIVVQVHGCKSWLLFPPETPLQSTRIPYE-----ETSVYCLENFYAP 189
            |.|.....:|.|.|. ..|.:.||.|.|...|:.||.  ..:..|:|     .||...:||   |
Zfish   300 WFGPGGTVSPLHQDP-QQNFLAQVVGRKYIRLYSPEE--TKSLYPHESQLLHNTSQVEVEN---P 358

  Fly   190 DPAKISSYEHLGRQAY-HCNLQPGNVLIVPRHWWHYVEAKSTSLSVNYW 237
            |..|...:   .|.:| .|.|.||:||.:|...||||.:...|.||::|
Zfish   359 DLVKFPDF---SRASYEECVLCPGDVLFIPLQHWHYVRSLELSFSVSFW 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPBAP1NP_651581.2 cupin_like 11..237 CDD:304367 58/237 (24%)
kdm8NP_001103339.2 Cupin_8 180..406 CDD:290351 60/244 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.