DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPBAP1 and JMJD7

DIOPT Version :9

Sequence 1:NP_651581.2 Gene:HSPBAP1 / 43329 FlyBaseID:FBgn0263025 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_648651.1 Gene:JMJD7 / 39514 FlyBaseID:FBgn0036366 Length:316 Species:Drosophila melanogaster


Alignment Length:281 Identity:67/281 - (23%)
Similarity:107/281 - (38%) Gaps:82/281 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PLVLEQFPLKWECFEGSLHDWCKRFDKEATCLPAFELMALADSS-----TPQW--ERKRTKSSQ- 73
            |:|:.: .|.|.    ::..|          .|.:.:.||.|.|     ||..  :...|::.| 
  Fly    46 PVVIRK-ALNWP----AIGKW----------TPKYLIEALGDRSVDVAITPNGYADGLATQNGQE 95

  Fly    74 --------LLNMQQFLRKYGVLDGDSTHWAAYQYKK-------ADEVPLSCR-SGIGFSSFGF-- 120
                    .:.:.:.:|:   || |.|....|..|:       ..|:....| |.:.|:...|  
  Fly    96 YFVLPLETKMKLSEVVRR---LD-DPTGAVHYIQKQNSNLSVDLPELAADLRVSDLDFAQQSFNK 156

  Fly   121 -PDIGNDYRFWLGSEQANTPCHYDTFGVNIVVQVHGCKSWLLFPPETPLQSTRIP--YEETSVYC 182
             ||..|   ||||.|:|.|..|.|.: .|:...:.|.|.::|.||.   |.:.:|  ...|.||.
  Fly   157 PPDAVN---FWLGDERAVTSMHKDPY-ENVYCVISGHKDFVLIPPH---QLSCVPRGIYPTGVYK 214

  Fly   183 LEN---FY----------------------APDPAKISSYEHLGRQAYHCNLQPGNVLIVPRHWW 222
            ..:   ||                      :||.||...|..  .:.....:..|::|.:|.:|:
  Fly   215 TSDSGQFYIEPLRDEEGSDQFTEWVSVDPLSPDLAKYPEYAR--AKPLKVRVHAGDILYLPNYWF 277

  Fly   223 HYVEAKSTSLSVNYWVPLKVD 243
            |:|......::||:|..|..|
  Fly   278 HHVSQSHKCIAVNFWYDLDYD 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPBAP1NP_651581.2 cupin_like 11..237 CDD:304367 64/273 (23%)
JMJD7NP_648651.1 Cupin_8 33..298 CDD:290351 66/279 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454789
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.