DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPBAP1 and hif1an

DIOPT Version :9

Sequence 1:NP_651581.2 Gene:HSPBAP1 / 43329 FlyBaseID:FBgn0263025 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_988915.1 Gene:hif1an / 394511 XenbaseID:XB-GENE-966944 Length:352 Species:Xenopus tropicalis


Alignment Length:320 Identity:74/320 - (23%)
Similarity:126/320 - (39%) Gaps:80/320 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ELSSKLRDLILNTHVPLVLEQFPLKWE--------------CFEGSLHDWCKRFDKEATCLPAFE 52
            ||..|...::| |...||  ...|||:              .:..:.|.:....:|:......|:
 Frog    57 ELIDKEEPVVL-TDTNLV--HTALKWDLDYLEENIGNGDFSVYSANSHKFLYYDEKKMVNFKNFK 118

  Fly    53 -LMALADSSTPQWERK-----RTKSSQLLNMQQFL-----RKYGVLD--GDSTHWAAYQYKKADE 104
             ..:..:...|::..|     ..:|.:.|.:||.|     ||. |:|  |.:.:|...|..|   
 Frog   119 PKSSREEMKFPEFVNKLKDIQERESDERLYLQQTLNDTVGRKI-VVDFLGFNWNWINKQQAK--- 179

  Fly   105 VPLSCRSGIGFSSFGFPDIGNDYRFWLGSEQANTPCHYDTFGVNIVVQVHGCKSWLLFPPET--- 166
                         .|:..:.::. ..:|.|...||.|||. ..|...|:.|.|..:|||||.   
 Frog   180 -------------HGWGQLTSNL-LLIGMEGNVTPAHYDE-QQNFFAQIKGYKRCILFPPEQFEC 229

  Fly   167 ----PLQSTRIPYEETSVYCLENFYAPDPAKISSYEH-LGRQAYHCNLQPGNVLIVPRHWWHYVE 226
                |:..   |.:..|....||   ||..:..::.: ||   |...:.||:||.:|.:|||::|
 Frog   230 LYPYPVHH---PCDRQSQVDFEN---PDFERFPNFRNVLG---YETVVGPGDVLYIPMYWWHHIE 285

  Fly   227 A---KSTSLSVNYW-----VPLKVDMDLILDEFLVMHIVESFVRGESNQVKQYLLNPNQL 278
            :   ...:::||:|     .|.:::..      |..|...:.:|.....:.:.|.||.::
 Frog   286 SLMDGGITITVNFWYKGAPTPKRIEYP------LKAHQKVAIMRNIEKMLGEALGNPQEV 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPBAP1NP_651581.2 cupin_like 11..237 CDD:304367 63/263 (24%)
hif1anNP_988915.1 Cupin_8 56..300 CDD:372651 66/273 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.