DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPBAP1 and JMJD5

DIOPT Version :10

Sequence 1:NP_651581.2 Gene:HSPBAP1 / 43329 FlyBaseID:FBgn0263025 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_612063.2 Gene:JMJD5 / 38097 FlyBaseID:FBgn0035166 Length:401 Species:Drosophila melanogaster


Alignment Length:31 Identity:10/31 - (32%)
Similarity:13/31 - (41%) Gaps:5/31 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 FLGPISH----NDICAWLAANEATYAK-HYA 137
            :|..:.|    |...|||...|:.... |||
  Fly    71 YLEEVGHLTKLNPQDAWLPITESRNGNAHYA 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPBAP1NP_651581.2 Cupin_8 <76..237 CDD:463936 10/31 (32%)
JMJD5NP_612063.2 Cupin_8 172..401 CDD:463936
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.