DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPBAP1 and Tyw5

DIOPT Version :9

Sequence 1:NP_651581.2 Gene:HSPBAP1 / 43329 FlyBaseID:FBgn0263025 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001163944.1 Gene:Tyw5 / 301419 RGDID:1311269 Length:315 Species:Rattus norvegicus


Alignment Length:133 Identity:38/133 - (28%)
Similarity:59/133 - (44%) Gaps:21/133 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 FPDIGNDYRF--WLGSEQ-------ANTP-----CHYDTFGVNIVVQVHGCKSWLLFPPETPLQS 170
            ||.:|.|..|  :...||       .::|     .|||... |.::||.|.|...||.|    :.
  Rat   125 FPSLGEDITFPMFFREEQFFSSVFRISSPGLQLWTHYDVMD-NFLIQVTGKKRITLFSP----RD 184

  Fly   171 TRIPYEETSVYCLENFYAPDPAKISSYEHLGRQAYHCNLQPGNVLIVPRHWWHYVEAKSTSLSVN 235
            .:..|...|...:.|..:||..|...:....|  |.|:|:.|:||.:|..|:|.|.::...:.||
  Rat   185 AQYLYLSGSKSEVLNIDSPDLDKYPLFPKARR--YECSLEAGDVLFIPALWFHNVVSEEFGVGVN 247

  Fly   236 YWV 238
            .::
  Rat   248 VFL 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPBAP1NP_651581.2 cupin_like 11..237 CDD:304367 38/130 (29%)
Tyw5NP_001163944.1 Cupin_8 17..264 CDD:290351 38/133 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.