DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPBAP1 and jmjd-5

DIOPT Version :9

Sequence 1:NP_651581.2 Gene:HSPBAP1 / 43329 FlyBaseID:FBgn0263025 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_505831.1 Gene:jmjd-5 / 179543 WormBaseID:WBGene00007387 Length:578 Species:Caenorhabditis elegans


Alignment Length:191 Identity:48/191 - (25%)
Similarity:85/191 - (44%) Gaps:38/191 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 STPQWERKRTKSSQLLNMQQFLRKYGVLDGDSTHWAAYQYKKADEVPLSCRSGIGFSSFGFPDI- 123
            |...|.:|      |:..::|:|     :.::......|::..|:||...|..|      .||: 
 Worm   411 SDENWSQK------LMTFKEFIR-----NSENERLYLAQHRLFDQVPHLKRDVI------IPDVC 458

  Fly   124 --------GNDYRFWLGSEQANTPCHYDTFGVNIVVQVHGCKSWLLFPPETPLQSTRIPYE---- 176
                    ..|...|:|.:...:|.|.|. ..|:.|||||.|.:.:..||:  ..:..|::    
 Worm   459 FGESSNPENVDMNMWIGPQDTVSPLHTDP-RKNMFVQVHGTKLFRMVAPES--SESVYPFDGILS 520

  Fly   177 ETSVYCLENFYAPDPAKISSYEHLGRQAYHCNLQPGNVLIVPRHWWHYVEAKSTSLSVNYW 237
            .||...:||   ||.....::|.:  :.....:.||:.:.:|..|||:|.:.|.|:|:::|
 Worm   521 NTSQVDVEN---PDLKIFPNFEQV--EVLDAVINPGDAIFIPEKWWHFVRSTSPSISISFW 576

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPBAP1NP_651581.2 cupin_like 11..237 CDD:304367 47/189 (25%)
jmjd-5NP_505831.1 NAT_SF 26..137 CDD:388411
Cupin_8 360..578 CDD:372651 48/191 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.