DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPBAP1 and Hspbap1

DIOPT Version :9

Sequence 1:NP_651581.2 Gene:HSPBAP1 / 43329 FlyBaseID:FBgn0263025 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_599246.2 Gene:Hspbap1 / 171460 RGDID:620870 Length:479 Species:Rattus norvegicus


Alignment Length:304 Identity:98/304 - (32%)
Similarity:141/304 - (46%) Gaps:45/304 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KLRDLILNTHVPLVLEQFPLKWECFEGSLHDWCKRFDKEATCLPAFELMALADSST-PQWERKRT 69
            |.:::|::...|.:.......|.    |.|...|...|..........|.|..:.| ||:|   |
  Rat    32 KAKEVIMSLQQPAIFCNMVFDWP----SRHWTAKHLSKVLEGKQIRFRMGLRSTGTVPQFE---T 89

  Fly    70 KSSQL-LNMQQFL-------------RKYGVLDGDSTHWAAYQYK--------KADEVPLSCRSG 112
            :.|.: ..:::||             :||    ..|..||...||        |.|..     ..
  Rat    90 ECSYVDATLEEFLAWNCDQSRISGPFKKY----DHSKFWAYADYKYFVTLFEDKTDVF-----QE 145

  Fly   113 IGFSSFGFPD-IGNDYRFWLGSEQANTPCHYDTFGVNIVVQVHGCKSWLLFPPE-TP-LQSTRIP 174
            :.:|.||||. .|.:...|:||..|:||||.|::|.|:|.||.|.|.|.||||| || |..||||
  Rat   146 VMWSDFGFPGRNGQESTLWIGSLGAHTPCHLDSYGCNLVFQVQGRKRWHLFPPEDTPFLYPTRIP 210

  Fly   175 YEETSVYCLENFYAPDPAKISSYEHLGRQAYHCNLQPGNVLIVPRHWWHYVEA-KSTSLSVNYWV 238
            |||:||:...|...||..:...::...|  :...|.||.||.||||||||||: ...::|:|.|:
  Rat   211 YEESSVFSKINVVNPDLKRFPQFQKARR--HMVTLSPGQVLFVPRHWWHYVESLDPVTVSINSWI 273

  Fly   239 PLKVDMDLILDEFLVMHIVESFVRGESNQVKQYLLNPNQLDNVS 282
            .|:.|....::|.:...:|.:....|.....:..|||.:::..|
  Rat   274 ELEEDHLARVEEAVTRMLVCTLKTAEDPHHPRTWLNPTEVEETS 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPBAP1NP_651581.2 cupin_like 11..237 CDD:304367 87/252 (35%)
Hspbap1NP_599246.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Cupin_8 37..272 CDD:404504 87/252 (35%)
Interaction with HSPB1. /evidence=ECO:0000269|PubMed:10751411 88..208 45/131 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 347..412
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338189
Domainoid 1 1.000 118 1.000 Domainoid score I5744
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385616at2759
OrthoFinder 1 1.000 - - FOG0008275
OrthoInspector 1 1.000 - - oto96101
orthoMCL 1 0.900 - - OOG6_109247
Panther 1 1.100 - - LDO PTHR12461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6251
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.850

Return to query results.
Submit another query.