DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPBAP1 and TYW5

DIOPT Version :9

Sequence 1:NP_651581.2 Gene:HSPBAP1 / 43329 FlyBaseID:FBgn0263025 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001034782.1 Gene:TYW5 / 129450 HGNCID:26754 Length:315 Species:Homo sapiens


Alignment Length:128 Identity:37/128 - (28%)
Similarity:63/128 - (49%) Gaps:21/128 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 FPDIGNDYRFWLGSEQANTP-----CHYDTFGVNIVVQVHGCKSWLLFPPETP----LQSTRIPY 175
            ||:...:.:|:....:.::|     .|||... |:::||.|.|..:||.|...    |:.|:   
Human   134 FPEFFKEEQFFSSVFRISSPGLQLWTHYDVMD-NLLIQVTGKKRVVLFSPRDAQYLYLKGTK--- 194

  Fly   176 EETSVYCLENFYAPDPAKISSYEHLGRQAYHCNLQPGNVLIVPRHWWHYVEAKSTSLSVN-YW 237
              :.|..::|   ||.||...:....|  |.|:|:.|:||.:|..|:|.|.::...:.|| :|
Human   195 --SEVLNIDN---PDLAKYPLFSKARR--YECSLEAGDVLFIPALWFHNVISEEFGVGVNIFW 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPBAP1NP_651581.2 cupin_like 11..237 CDD:304367 36/126 (29%)
TYW5NP_001034782.1 Cupin_8 17..255 CDD:404504 37/128 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.