powered by:
Protein Alignment HSPBAP1 and CG43319
DIOPT Version :9
Sequence 1: | NP_651581.2 |
Gene: | HSPBAP1 / 43329 |
FlyBaseID: | FBgn0263025 |
Length: | 398 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001247340.1 |
Gene: | CG43319 / 12798278 |
FlyBaseID: | FBgn0263024 |
Length: | 57 |
Species: | Drosophila melanogaster |
Alignment Length: | 40 |
Identity: | 11/40 - (27%) |
Similarity: | 16/40 - (40%) |
Gaps: | 12/40 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 86 VLDGDSTHWAAYQYKKADEVPLSCRSGIGFSSFGFPDIGN 125
|..|....|..|: || .:|.||: :..:||
Fly 17 VASGQKGKWKGYK----DE-------EMGKSSY-WKKVGN 44
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
HSPBAP1 | NP_651581.2 |
cupin_like |
11..237 |
CDD:304367 |
11/40 (28%) |
CG43319 | NP_001247340.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG2132 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.