DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPBAP1 and tyw5

DIOPT Version :9

Sequence 1:NP_651581.2 Gene:HSPBAP1 / 43329 FlyBaseID:FBgn0263025 Length:398 Species:Drosophila melanogaster
Sequence 2:XP_002937758.2 Gene:tyw5 / 100493826 XenbaseID:XB-GENE-6041227 Length:317 Species:Xenopus tropicalis


Alignment Length:201 Identity:51/201 - (25%)
Similarity:73/201 - (36%) Gaps:53/201 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LNMQQFLRK---YGVLDGD--------STHWA-------AYQYKKADEVPLSCRSGIGFSSFGFP 121
            |....|:||   |..|..|        ..|.|       .|..:...|.|   |..|...|..||
 Frog    67 LPQMDFIRKNFLYRTLPFDIFVQRAAEEKHTAFFISENEKYYLRSLGEDP---RKDIADISKQFP 128

  Fly   122 DIGNDYR--------------FWLGSEQANTPCHYDTFGVNIVVQVHGCKSWLLFPPETPLQSTR 172
            .:..|.:              |.:.|.......|||... |:::||.|.|..:|:.|..      
 Frog   129 HLATDIQIPEFFEKDQFFSSVFRISSPGLQLWTHYDVMD-NLLIQVTGKKRVVLYSPRD------ 186

  Fly   173 IPY-----EETSVYCLENFYAPDPAKISSYEHLGRQAYHCNLQPGNVLIVPRHWWHYVEAKSTSL 232
            .||     :::.|..::|   .|..|...:.|..|  |.|.|:.|:||.:|..|:|...|....:
 Frog   187 APYLYLSGDKSEVLDVDN---TDLVKYPLFSHARR--YECYLEAGDVLFIPALWFHNTVAVGFGV 246

  Fly   233 SVN-YW 237
            .|| :|
 Frog   247 GVNVFW 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPBAP1NP_651581.2 cupin_like 11..237 CDD:304367 50/199 (25%)
tyw5XP_002937758.2 Cupin_8 20..258 CDD:404504 51/201 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.