DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPBAP1 and kdm8

DIOPT Version :9

Sequence 1:NP_651581.2 Gene:HSPBAP1 / 43329 FlyBaseID:FBgn0263025 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001121525.1 Gene:kdm8 / 100158649 XenbaseID:XB-GENE-5811534 Length:443 Species:Xenopus tropicalis


Alignment Length:248 Identity:66/248 - (26%)
Similarity:100/248 - (40%) Gaps:47/248 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RDLILNTHVPLVLEQFPLKWECFEGSLHDWCKRF-DKEATC--LPAFELMALADSST-PQWERKR 68
            ||..|....|:|||.....|.|    |..|...: .:.|.|  :|    :.|....| .:|    
 Frog   223 RDHYLVPQKPVVLEGVIDHWPC----LKKWSVEYIQRVAGCRTVP----VELGSRYTDAEW---- 275

  Fly    69 TKSSQLLNMQQFLRKYGVLDGDSTHWAAYQYKKADEVPLSCRSGIGFSSFGFPD---IGN----- 125
              |.:|:.:.:|:.|| :||..:......|::..:::| ..:..|     ..||   :|.     
 Frog   276 --SQRLMTVNEFITKY-ILDKQNGIGYLAQHQLFEQIP-ELKEDI-----CIPDYCCLGEASEDE 331

  Fly   126 -DYRFWLGSEQANTPCHYDTFGVNIVVQVHGCKSWLLFP-PET----PLQSTRIPYEETSVYCLE 184
             ....|.|.....:|.|.|. ..|.:.|:.|.|...::. .||    |..|:.:  ..||...:|
 Frog   332 ITINAWFGPAGTVSPLHQDP-QQNFLAQIVGRKYIRVYSVAETEKLYPFDSSIL--HNTSQVDVE 393

  Fly   185 NFYAPDPAKISSYEHLGRQAYHCNLQPGNVLIVPRHWWHYVEAKSTSLSVNYW 237
               :||..|...:.....|  .|.|.||.||.:|..||||:.|...|.||::|
 Frog   394 ---SPDQNKFPRFSQASYQ--ECILSPGQVLFIPVKWWHYIRALDLSFSVSFW 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPBAP1NP_651581.2 cupin_like 11..237 CDD:304367 63/243 (26%)
kdm8NP_001121525.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..174
Cupin_8 222..443 CDD:372651 66/248 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.