DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPBAP1 and Jmjd7

DIOPT Version :9

Sequence 1:NP_651581.2 Gene:HSPBAP1 / 43329 FlyBaseID:FBgn0263025 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001108128.1 Gene:Jmjd7 / 100137086 RGDID:2290039 Length:316 Species:Rattus norvegicus


Alignment Length:329 Identity:74/329 - (22%)
Similarity:120/329 - (36%) Gaps:100/329 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ELSSKLRDLILNTHVPLVLEQ-----FPLKWEC------FEGSLHDWCKRFDKEATCLPAFE--- 52
            |..:..|||.:...||.:.|.     |...|.|      ...:|..|           ||.:   
  Rat    15 EFPAAARDLNVPRVVPYLDEPPSPLCFYRDWVCPNRPCIIRNALQHW-----------PALQKWS 68

  Fly    53 ---LMALADSS------TPQW-------------ERKRTKSSQLLNMQQFLRKYGVLDGDSTH-W 94
               |.|...|:      ||..             ..:|...|.:|:         ||:|.:.| .
  Rat    69 FSYLRATVGSTEVSVAVTPDGYADAVRGDRFVMPAERRLPVSHVLD---------VLEGQAQHPG 124

  Fly    95 AAYQYKKADEVPL-------SCRSGIGFSSFGFPDIGNDYRFWLGSEQANTPCHYDTFGVNIVVQ 152
            ..|..|:...:|.       ...|.:.::|.....:.:...||||...|.|..|.|.: .|:...
  Rat   125 VLYVQKQCSNLPTELPQLLSDIESHVPWASESLGKMPDAVNFWLGDAAAVTSLHKDHY-ENLYCV 188

  Fly   153 VHGCKSWLLFPP-ETPLQSTRIPY-----------EETSVYCLE------------NFYAPDPAK 193
            |.|.|.:||.|| :.|.    |||           ||.:...::            :..|||.|:
  Rat   189 VSGEKHFLLHPPSDRPF----IPYNLYTPATYQLTEEGTFRVVDEEAMEKVPWIPLDPLAPDLAR 249

  Fly   194 ISSYEHLGRQAYHCNLQPGNVLIVPRHWWHYVEAKSTSLSVNYWVPLKVDMDLILDEFLVMHIVE 258
            ..||..  .:|.||.::.|.:|.:|..|:|:|:.....::||:|..::.|:     ::....:::
  Rat   250 YPSYSQ--ARALHCTVRAGELLYLPALWFHHVQQSHGCIAVNFWYDMEYDL-----KYSYFQLMD 307

  Fly   259 SFVR 262
            |..|
  Rat   308 SLTR 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPBAP1NP_651581.2 cupin_like 11..237 CDD:304367 66/293 (23%)
Jmjd7NP_001108128.1 Cupin_8 38..297 CDD:290351 64/285 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.