DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sce and RING1B

DIOPT Version :9

Sequence 1:NP_477509.1 Gene:Sce / 43327 FlyBaseID:FBgn0003330 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001184901.1 Gene:RING1B / 839413 AraportID:AT1G03770 Length:468 Species:Arabidopsis thaliana


Alignment Length:384 Identity:100/384 - (26%)
Similarity:156/384 - (40%) Gaps:93/384 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ITDSTEIAVSPRSLHSELMCPICLDMLKKTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVS 91
            :::|..:.|....:..::.|.|||.:::||.|..|||||||.:||..::|.||.|||||||...|
plant    86 LSESEYMVVDLADICKDVQCSICLGIIRKTRTVMECLHRFCRECIDKSMRLGNNECPTCRKHCAS 150

  Fly    92 KRSLRADPNFDLLISKIYPS-----------REEYEAIQEKVMAKFNQTQSQQ--ALV--NSINE 141
            :||||.|||||.||:.::.:           |::.||..:::.|...|...:|  |||  .|:.:
plant   151 RRSLRDDPNFDALIAALFKNIDKFEEEELNFRQDDEARNKQIQASIAQVSQRQSKALVKRKSVGK 215

  Fly   142 GIKLQSQNRPQRFRTKGGGGGGGGGGNGNGAANVAAPPAPGAPTAVGRNASNQMHVHDTASNDSN 206
            |..:.|::|      :.|||                       :...||..|.......|::|.:
plant   216 GTAILSRSR------RSGGG-----------------------SRRRRNCRNIEQDTSEANDDDD 251

  Fly   207 SNTNSIDRENRDPGHSGTSAASAITSASNAAPSSSANSGASTSATRMQVDDASNPPSV------- 264
            .|....|..:.:|........||...:|:.|.::...:|..|..|..:.....:|..|       
plant   252 QNKRGKDSSSDEPCERQRKKRSATQPSSSNANNNDNCAGNGTEQTHQRDSRVISPVLVWNSELIA 316

  Fly   265 ------RSTPSPVPSNSS-----SSKPKRAMSVLTSERSEESESDSQMDCRTEGDSNIDTEGEGN 318
                  ||......:|..     :::.||.:..|.|......|.|..:..     .::||||..|
plant   317 WGRGGTRSNTRQGNNNQGAISKRNARLKRLVEYLGSLEGNSVELDIHLKL-----VSLDTEGLLN 376

  Fly   319 GELGINDEIELVFKPHPTEMSADNQLIRALKENCVRYIKTTANATVDHLSKYLAMRLTL 377
                 ..|..|.|:|        ..|::.|:|             |..|..|:|..|.|
plant   377 -----LHEPYLCFRP--------TLLVKQLRE-------------VSSLPLYVARHLKL 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SceNP_477509.1 RING 45..89 CDD:238093 26/43 (60%)
RAWUL 336..431 CDD:292824 9/42 (21%)
RING1BNP_001184901.1 RING 104..148 CDD:238093 26/43 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 65 1.000 Domainoid score I3621
eggNOG 1 0.900 - - E1_KOG0311
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 110 1.000 Inparanoid score I2068
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003138
OrthoInspector 1 1.000 - - otm2621
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2531
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.