DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Sce and Traip

DIOPT Version :9

Sequence 1:	NP_477509.1	Gene:	Sce / 43327	FlyBaseID:	FBgn0003330	Length:	435	Species:	Drosophila melanogaster
Sequence 2:	NP_035764.2	Gene:	Traip / 22036	MGIID:	1096377	Length:	470	Species:	Mus musculus

Alignment Length:	115	Identity:	24/115 - (20%)
Similarity:	55/115 - (47%)	Gaps:	15/115 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly    45 MCPICLDML--KKTMTTKECLHRFCSDCIVTALRSG-NKECPTCRKKLVSKRSLRADPNFDL--- 103
            :|.||.|..  .:.:....|.|.|...|::....:. ::.||.||.: |.|:::.....|||
Mouse     6 LCTICSDFFDHSRDVAAIHCGHTFHLQCLIQWFETAPSRTCPQCRIQ-VGKKTIINKLFFDLAQE 69

  Fly   104 ----LISKIYPSREEYEAIQEKVMAKFNQTQSQQALVNSINEGIKLQSQN 149
                |.::..  :.|.::::.::..|..:.:..||:::::.:  .|:.:|
Mouse    70 EENVLDAEFL--KNELDSVKAQLSQKDREKRDSQAIIDTLRD--TLEERN 115

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Sce	NP_477509.1	RING	45..89	CDD:238093	12/46 (26%)
Sce	NP_477509.1	RAWUL	336..431	CDD:292824
Traip	NP_035764.2	zf-RING_2	7..50	CDD:290367	10/42 (24%)
		BRE1	204..>271	CDD:285810
		Interaction with CYLD. /evidence=ECO:0000250\|UniProtKB:Q9BWF2	211..470
		PIP-box. /evidence=ECO:0000250\|UniProtKB:Q9BWF2	461..470
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R3349
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.940