DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sce and Brca1

DIOPT Version :9

Sequence 1:NP_477509.1 Gene:Sce / 43327 FlyBaseID:FBgn0003330 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_033894.3 Gene:Brca1 / 12189 MGIID:104537 Length:1812 Species:Mus musculus


Alignment Length:419 Identity:85/419 - (20%)
Similarity:148/419 - (35%) Gaps:155/419 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ELSLYELQRKPQEVITDSTEIAVSPRSLHSELMCPICLDMLKKTMTTKECLHRFCSDCIVTAL-- 75
            :||..::| :.|.|:          .::...|.|||||:::|:.::|| |.|.||..|::..|  
Mouse     2 DLSAVQIQ-EVQNVL----------HAMQKILECPICLELIKEPVSTK-CDHIFCKFCMLKLLNQ 54

  Fly    76 RSGNKECPTCRKKLVSKRSLRADPNFDLLISKIYPSREEYEAIQEKVMAKFNQTQSQQALVNSIN 140
            :.|..:||.|:.: ::||||:....|..|..::.           ::||.|           .::
Mouse    55 KKGPSQCPLCKNE-ITKRSLQGSTRFSQLAEELL-----------RIMAAF-----------ELD 96

  Fly   141 EGIKLQSQNRPQRFRTKGGGGGGGGGGNGNGAANVAAPPAPGAPTAVGRNASNQMHVHDTASNDS 205
            .|::|.                       ||                              .:.|
Mouse    97 TGMQLT-----------------------NG------------------------------FSFS 108

  Fly   206 NSNTNSIDRENRDPGHSGTSAASAITSAS-----NAAPSSSANSGASTSATRMQVDDASNPPSVR 265
            ....||.:|.|.:        ||.|.|..     ...|.....:.....:..:|:   ||...||
Mouse   109 KKRNNSCERLNEE--------ASIIQSVGYRNRVRRLPQVEPGNATLKDSLGVQL---SNLGIVR 162

  Fly   266 STPSPVPSNSSSSKPKRAMSV-LTSERSEESESDSQMDCRTEGDSNIDTEGEGNGELGINDEIEL 329
            |    |..|..:...|:::.: |.|:.|||:.: ...||.......:.|..:..|:.|       
Mouse   163 S----VKKNRQTQPRKKSVYIELDSDSSEETVT-KPGDCSVRDQELLQTAPQEAGDEG------- 215

  Fly   330 VFKPHPTEMSA--DNQLIRALKEN-CVRYIKTTAN-ATVDHLSKYLAMRLTLDLGADLPEACR-- 388
              |.|..|.:|  .::.||.::.: |...:..|.| ||..|                 ||.|:  
Mouse   216 --KLHSAEEAACEFSEGIRNIEHHQCSDDLNPTENHATERH-----------------PEKCQSI 261

  Fly   389 -VLNFCI----------YVAPQPQQLVIL 406
             :.|.|:          .:.|:...|:::
Mouse   262 SISNVCVEPCGTDAHASSLQPETSSLLLI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SceNP_477509.1 RING 45..89 CDD:238093 18/45 (40%)
RAWUL 336..431 CDD:292824 17/88 (19%)
Brca1NP_033894.3 rad18 15..>172 CDD:273165 50/258 (19%)
RING-HC_BRCA1 18..65 CDD:319412 18/47 (38%)
RING-HC finger (C3HC4-type) 24..64 CDD:319412 17/40 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..198 9/33 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 321..362
BRCT_assoc 342..503 CDD:372330
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 492..581
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 640..767
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 864..899
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 947..995
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1030..1056
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1147..1185
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1205..1230
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1244..1289
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1313..1343
Interaction with PALB2. /evidence=ECO:0000250 1353..1380
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1437..1547
BRCT_BRCA1_rpt1 1593..1689 CDD:349367
BRCT_BRCA1_rpt2 1700..1797 CDD:349353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3349
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.