DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sce and PCGF3

DIOPT Version :9

Sequence 1:NP_477509.1 Gene:Sce / 43327 FlyBaseID:FBgn0003330 Length:435 Species:Drosophila melanogaster
Sequence 2:NP_001304765.1 Gene:PCGF3 / 10336 HGNCID:10066 Length:242 Species:Homo sapiens


Alignment Length:392 Identity:72/392 - (18%)
Similarity:119/392 - (30%) Gaps:168/392 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LHSELMCPICLDMLKKTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRADPNFDLL 104
            :::.:.|.:|...|....|..||||.||..|:|..|.. |..|||||                ::
Human    11 INAHITCRLCSGYLIDATTVTECLHTFCRSCLVKYLEE-NNTCPTCR----------------IV 58

  Fly   105 ISKIYPSREEYEAIQEKVMAKFNQTQSQQALVNSINEGIKLQSQNRPQRFRTKGGGGGGGGGGNG 169
            |.:.:|            :......::.|.:|..:..|::.....:.:.|..|.|          
Human    59 IHQSHP------------LQYIGHDRTMQDIVYKLVPGLQEAEMRKQREFYHKLG---------- 101

  Fly   170 NGAANVAAPPAPGAPTAVGRNASNQMHVHDTASNDSNSNTNSIDRENRDPGHSGTSAASAITSAS 234
                    ...||  ...|...|.:.|:      ||:.|..:                       
Human   102 --------MEVPG--DIKGETCSAKQHL------DSHRNGET----------------------- 127

  Fly   235 NAAPSSSANSGASTSATRMQVDDASNPPSVRSTPSPVPSNSSSSKPKRAMSVLTSERSEESESDS 299
                               :.||:||            ..::..||:        |.::...||.
Human   128 -------------------KADDSSN------------KEAAEEKPE--------EDNDYHRSDE 153

  Fly   300 QMDCRTEGDSNIDTEGEGNGELGINDEIELVFKPHPTEMSADNQLIRALKENCVRYIKTTANATV 364
            |:....|.:|:                                 .:|.||.   ::|:.:|.|||
Human   154 QVSICLECNSS---------------------------------KLRGLKR---KWIRCSAQATV 182

  Fly   365 DHLSKYLAMRLTLDLGADLPEACRVLNFCIYVAPQPQQLVILNGNQTLHQVNDKFWKVNK-PMEM 428
            .||.|::|.:|.|....:|...|..              .||..:.||..|....|:..| |:.:
Human   183 LHLKKFIAKKLNLSSFNELDILCNE--------------EILGKDHTLKFVVVTRWRFKKAPLLL 233

  Fly   429 YY 430
            :|
Human   234 HY 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SceNP_477509.1 RING 45..89 CDD:238093 19/43 (44%)
RAWUL 336..431 CDD:292824 25/96 (26%)
PCGF3NP_001304765.1 RING-HC_PCGF3 14..60 CDD:319649 19/62 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..149 11/101 (11%)
Interaction with BCORL1. /evidence=ECO:0000269|PubMed:27568929 132..242 35/174 (20%)
RAWUL_PCGF3 154..236 CDD:340603 28/132 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.