DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and SPS19

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_014197.2 Gene:SPS19 / 855518 SGDID:S000005146 Length:292 Species:Saccharomyces cerevisiae


Alignment Length:246 Identity:67/246 - (27%)
Similarity:98/246 - (39%) Gaps:29/246 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GRTLFITGASRGIGKE-------IALKAA---RDGANIVVAAKTAEPHPKLPGTIYSAAEEIEKA 63
            |:..|:||.:..|.:.       :..|||   ||......|||......|....:.:.|.     
Yeast    24 GKVAFVTGGAGTICRVQTEALVLLGCKAAIVGRDQERTEQAAKGISQLAKDKDAVLAIAN----- 83

  Fly    64 GGKAYPCVVDVRDEQQVRSAVEAAVAKFGGIDIVINNASAISLTNTPDTDMKRYDLMHNINTRGT 128
                    ||||:.:||.:||:..|.|||.||.||..|:...:.:..:.....:..:.:|:..|:
Yeast    84 --------VDVRNFEQVENAVKKTVEKFGKIDFVIAGAAGNFVCDFANLSPNAFKSVVDIDLLGS 140

  Fly   129 FLVSKVCLPYLKKSNHAHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFKDEGISVN 193
            |..:|.||..||||. ..||.:|.........|..||.  .||.|:......:|.|....||..|
Yeast   141 FNTAKACLKELKKSK-GSILFVSATFHYYGVPFQGHVG--AAKAGIDALAKNLAVELGPLGIRSN 202

  Fly   194 ALWPRTAIHTAAIEMLTGPDSAKWSRKPEIMADAAYAILTREPRQSTGQFF 244
            .:.|....:|..::.|.|   .|:..|............||:..:||...|
Yeast   203 CIAPGAIDNTEGLKRLAG---KKYKEKALAKIPLQRLGSTRDIAESTVYIF 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 67/246 (27%)
PRK08278 7..277 CDD:181349 67/246 (27%)
SCP2 317..406 CDD:280250
SPS19NP_014197.2 TER_DECR_SDR_a 22..270 CDD:187627 67/246 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.