DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and IRC24

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_012302.3 Gene:IRC24 / 854854 SGDID:S000001475 Length:263 Species:Saccharomyces cerevisiae


Alignment Length:200 Identity:48/200 - (24%)
Similarity:95/200 - (47%) Gaps:25/200 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GRTLFITGASRGIGKEIALKAARDGANIVV--AAKTAEPHPKLPGTIYSAAEEIEKAGG--KAYP 69
            |:.:.|||||||||.::......:....:|  .|:|.           :..:.:::..|  |...
Yeast     2 GKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTE-----------AGLQSLQREYGADKFVY 55

  Fly    70 CVVDVRDEQQVRSAVEAAVAKFGGIDIVINNA------SAISLTNTPDTDMKRYDLMHNINTRGT 128
            .|:|:.|..::.:.||....|.|.:|.::.||      .:||.:|: :.|:|:::.:.::|....
Yeast    56 RVLDITDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNS-EHDIKQWERLFDVNFFSI 119

  Fly   129 FLVSKVCLPYLKKSNH-AHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFKDEGISV 192
            ..:..:|||.||.|.. .:|:.:|...|:||  :....||..:|..::...:.:|:|...:.:..
Yeast   120 VSLVALCLPLLKSSPFVGNIVFVSSGASVKP--YNGWSAYGCSKAALNHFAMDIASEEPSDKVRA 182

  Fly   193 NALWP 197
            ..:.|
Yeast   183 VCIAP 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 47/199 (24%)
PRK08278 7..277 CDD:181349 47/199 (24%)
SCP2 317..406 CDD:280250
IRC24NP_012302.3 SPR-like_SDR_c 4..255 CDD:187625 46/197 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341297
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.