Sequence 1: | NP_651578.1 | Gene: | CG5590 / 43325 | FlyBaseID: | FBgn0039537 | Length: | 412 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_012302.3 | Gene: | IRC24 / 854854 | SGDID: | S000001475 | Length: | 263 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 200 | Identity: | 48/200 - (24%) |
---|---|---|---|
Similarity: | 95/200 - (47%) | Gaps: | 25/200 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 GRTLFITGASRGIGKEIALKAARDGANIVV--AAKTAEPHPKLPGTIYSAAEEIEKAGG--KAYP 69
Fly 70 CVVDVRDEQQVRSAVEAAVAKFGGIDIVINNA------SAISLTNTPDTDMKRYDLMHNINTRGT 128
Fly 129 FLVSKVCLPYLKKSNH-AHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFKDEGISV 192
Fly 193 NALWP 197 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5590 | NP_651578.1 | FabG | 5..245 | CDD:223959 | 47/199 (24%) |
PRK08278 | 7..277 | CDD:181349 | 47/199 (24%) | ||
SCP2 | 317..406 | CDD:280250 | |||
IRC24 | NP_012302.3 | SPR-like_SDR_c | 4..255 | CDD:187625 | 46/197 (23%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C157341297 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |