DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and OAR1

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_012868.1 Gene:OAR1 / 853810 SGDID:S000001538 Length:278 Species:Saccharomyces cerevisiae


Alignment Length:276 Identity:61/276 - (22%)
Similarity:107/276 - (38%) Gaps:66/276 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEKAGGKAY--PCVVDV-- 74
            :|||:|||||.|..|..:.|.:.::...|.|...:      :|.:..:...|.:|  .|.:.:  
Yeast     9 VTGATRGIGKAICQKLFQKGLSCIILGSTKESIER------TAIDRGQLQSGLSYQRQCAIAIDF 67

  Fly    75 ------------------RDE---QQVRSAVEAAVAKFGG------IDIVINNA----SAISLTN 108
                              :|.   :|..|.:.....|:..      ::::||.|    .::|:..
Yeast    68 KKWPHWLDYESYDGIEYFKDRPPLKQKYSTLFDPCNKWSNNERRYYVNLLINCAGLTQESLSVRT 132

  Fly   109 TPDTDMKRYDLMHNINTRGTFLVSKVCLPYLKKSN-----------HAHILNISPPL-SMKPKWF 161
            |..   :..|:| |:|......::.:|:.|:.||.           ...|:|||..| |.|.|..
Yeast   133 TAS---QIQDIM-NVNFMSPVTMTNICIKYMMKSQRRWPELSGQSARPTIVNISSILHSGKMKVP 193

  Fly   162 GPHVAYTMAKYGMSMCVLGMAAEFKDEGISVNALWPRTAIHTAAI--------EMLTGPDSAKWS 218
            |..| |:.:|..:|.....:|||.:...|....:.|.....|..|        |||.....|..:
Yeast   194 GTSV-YSASKAALSRFTEVLAAEMEPRNIRCFTISPGLVKGTDMIQNLPVEAKEMLERTIGASGT 257

  Fly   219 RKPEIMADAAYAILTR 234
            ..|..:|:..:::.:|
Yeast   258 SAPAEIAEEVWSLYSR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 61/276 (22%)
PRK08278 7..277 CDD:181349 61/276 (22%)
SCP2 317..406 CDD:280250
OAR1NP_012868.1 SDR_c 7..275 CDD:212491 61/276 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.