DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsdl2 and ABA2

DIOPT Version :10

Sequence 1:NP_651578.1 Gene:Hsdl2 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_175644.1 Gene:ABA2 / 841665 AraportID:AT1G52340 Length:285 Species:Arabidopsis thaliana


Alignment Length:203 Identity:57/203 - (28%)
Similarity:94/203 - (46%) Gaps:27/203 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KLAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEKAGGK--AY 68
            :|.|:...|||.:.|||:.|.....:.||.:.:    .:....|.|.:   .:.:.:...|  |:
plant    17 RLLGKVALITGGATGIGESIVRLFHKHGAKVCI----VDLQDDLGGEV---CKSLLRGESKETAF 74

  Fly    69 PCVVDVRDEQQVRSAVEAAVAKFGGIDIVINNASAISLTNTPDTDMKRYDLMH-----NINTRGT 128
            ....|||.|..:.:||:.||..||.:||:||||   .|...|..|::.|.|..     ::|.:|.
plant    75 FIHGDVRVEDDISNAVDFAVKNFGTLDILINNA---GLCGAPCPDIRNYSLSEFEMTFDVNVKGA 136

  Fly   129 FL----VSKVCLPYLKKSNHAHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFKDEG 189
            ||    .::|.:|. ||.:...:.::...:.    ..||| :|..:|:.:......:|||....|
plant   137 FLSMKHAARVMIPE-KKGSIVSLCSVGGVVG----GVGPH-SYVGSKHAVLGLTRSVAAELGQHG 195

  Fly   190 ISVNALWP 197
            |.||.:.|
plant   196 IRVNCVSP 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsdl2NP_651578.1 PRK08278 7..277 CDD:181349 57/202 (28%)
SCP2 306..408 CDD:442486
ABA2NP_175644.1 PLN02253 3..285 CDD:177895 57/203 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.