DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsdl2 and NOL

DIOPT Version :10

Sequence 1:NP_651578.1 Gene:Hsdl2 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_568145.1 Gene:NOL / 830372 AraportID:AT5G04900 Length:348 Species:Arabidopsis thaliana


Alignment Length:205 Identity:51/205 - (24%)
Similarity:89/205 - (43%) Gaps:22/205 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEKAGGKAYPCVVDVRD 76
            :.|||:::|||..:|.:..:.|.|:|:.:::||   ::...:.|..||.   |...:....||.:
plant    82 ILITGSTKGIGYALAREFLKAGDNVVICSRSAE---RVETAVQSLKEEF---GEHVWGTKCDVTE 140

  Fly    77 EQQVRSAVEAAVAKFGGIDIVINNASAISLTNTPDTDMKRYDLMHNI--NTRGTFLVSKVCL-PY 138
            .:.||..|..:......|||.||||.:.:.:..|..:....||:..:  ||.|..|..:..: ..
plant   141 GKDVRELVAYSQKNLKYIDIWINNAGSNAYSFKPLAEASDEDLIEVVKTNTLGLMLCCREAMNMM 205

  Fly   139 LKKSNHAHILNISPPLS---MKPKWFGPHVAYTMAKYGMSMCVLGMAAEFKDEGISVNALWPRTA 200
            |.:|...||.||....|   ..|::    .||...|..:......:.||.:.:.:.      ...
plant   206 LTQSRGGHIFNIDGAGSDGRPTPRF----AAYGATKRSVVHLTKSLQAELQMQDVK------NVV 260

  Fly   201 IHTAAIEMLT 210
            :|..:..|:|
plant   261 VHNLSPGMVT 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsdl2NP_651578.1 PRK08278 7..277 CDD:181349 51/205 (25%)
SCP2 306..408 CDD:442486
NOLNP_568145.1 PLN02657 17..>140 CDD:178263 18/63 (29%)
SDR_c 82..302 CDD:212491 51/205 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.