DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and MGC147226

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:XP_012816817.1 Gene:MGC147226 / 780086 XenbaseID:XB-GENE-5822220 Length:521 Species:Xenopus tropicalis


Alignment Length:223 Identity:57/223 - (25%)
Similarity:98/223 - (43%) Gaps:29/223 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KLAGRTLFITGASRGIGKEIALKAARDGANIVVA---AKTAEPHPKLPGTIYSAAEEIEKAGGKA 67
            :|.||..::||..:|||:..|......||.:.|.   .:.||          :.|.|::..|.|:
 Frog   273 RLDGRVAYVTGGGQGIGRAFAHALGEAGAKVAVVDLMLEKAE----------AVAFELQVKGIKS 327

  Fly    68 YPCVVDVRDEQQVRSAVEAAVAKFGGIDIVINNASAISLTNTPDTDMKRYDLMHNINTRGTFLVS 132
            .....|:..|:.|:..|:..|..:|.|||..|||.....:.:.||.::.:|...::|.||.|:..
 Frog   328 VAIAADISKEEDVKRIVDTIVTNWGRIDIACNNAGINMNSASEDTTLEEWDKTFSVNLRGLFMCC 392

  Fly   133 KVCLPYLKKSNHAHILNISPPLSMKPKWFGPH----VAYTMAKYGMSMCVLGMAAEFKDEGISVN 193
            :.....:....:..|:|.:...|:    ..||    :||..:|.|:......:..|:.|.|:.||
 Frog   393 QAAGRVMLSQGYGKIINTASMASL----IVPHPQKQLAYNTSKAGVVKLTQTLGTEWIDRGVRVN 453

  Fly   194 ALWP----RTAIHTAAIEMLTGPDSAKW 217
            .:.|    ...||:.|::.|.    .:|
 Frog   454 CISPGIVDTPLIHSDALKPLV----QRW 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 57/223 (26%)
PRK08278 7..277 CDD:181349 57/222 (26%)
SCP2 317..406 CDD:280250
MGC147226XP_012816817.1 AdoMet_MTases 78..241 CDD:388410
NADB_Rossmann 269..518 CDD:389744 57/223 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.