DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and stoml1

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001039193.1 Gene:stoml1 / 734047 XenbaseID:XB-GENE-990189 Length:361 Species:Xenopus tropicalis


Alignment Length:141 Identity:44/141 - (31%)
Similarity:78/141 - (55%) Gaps:10/141 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 DKLMVDFFVEEKGAPVENEAAAEDAAAPASGGDVKIPQLFRKIESLLSPEIVSKTQAVFQFNIS- 332
            |:|::.|....:.:...:..:.:|.       |:.:.||..|:|:.|:..:||:..:.:|..:: 
 Frog   226 DQLLMQFLALTRQSSGNDSPSLKDT-------DLSLKQLLSKVEASLTESLVSEVGSSYQLYVTM 283

  Fly   333 -GAEQGTWFLDLKNGSGSCGAGTPTAAPDATLTMNSKNFFDMFSGKLKAAPAYMTGKLKISGDFQ 396
             |.:...:|||||:|||:||.|. ...||.||.|...:...:..|.|....||..|:|::||:.|
 Frog   284 PGGQISEYFLDLKSGSGNCGWGV-HPCPDVTLEMTEADLMSLICGDLHPLTAYTGGRLRVSGNIQ 347

  Fly   397 KALKLEKLMKA 407
            .||:||::::|
 Frog   348 TALQLERVLRA 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959
PRK08278 7..277 CDD:181349 3/7 (43%)
SCP2 317..406 CDD:280250 33/90 (37%)
stoml1NP_001039193.1 PHB 60..198 CDD:214581
SPFH_SLP-1 75..205 CDD:259814
SCP2 254..357 CDD:280250 38/103 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.