DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and Bdh2

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001165526.1 Gene:Bdh2 / 69772 MGIID:1917022 Length:255 Species:Mus musculus


Alignment Length:261 Identity:70/261 - (26%)
Similarity:114/261 - (43%) Gaps:38/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GKLAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEKAGGKAYP 69
            |:|.|:.:.:|.|::|||:..||..||:||. |:|....|          |..:|:|...| ...
Mouse    12 GRLDGKVIVLTAAAQGIGRASALAFAREGAK-VIATDINE----------SKLQELESYRG-IQT 64

  Fly    70 CVVDVRDEQQVRSAVEAAVAKFGGIDIVINNASAISLTNTPDTDMKRYDLMHNINTRGTFLVSKV 134
            .|:||..::|    ::...::...||::.|.|..:......|.:.|.:|...|:|.|..||:.|.
Mouse    65 RVLDVTKKRQ----IDQFASEIERIDVLFNVAGFVHHGTILDCEEKDWDFSMNLNVRSMFLMIKA 125

  Fly   135 CLPYLKKSNHAHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFKDEGISVNALWPRT 199
            .||.:......:|:|:| .::...|.......|:..|..:......:||:|..:||..|.:.|.|
Mouse   126 FLPKMLAQKSGNIINMS-SVASSIKGVENRCVYSATKAAVIGLTKSVAADFIQQGIRCNCVCPGT 189

  Fly   200 AIHTAAIEMLTGPDSAKWSRKPEIMADAAYAILTREPRQSTGQFFVDDEVL---------ESAGI 255
            ....:..|.:...|:.|            .|:.|...||.||:|...:||.         |||.:
Mouse   190 VDTPSLQERIQARDNPK------------EALKTFLNRQKTGRFASAEEVALLCVYLASDESAYV 242

  Fly   256 T 256
            |
Mouse   243 T 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 64/239 (27%)
PRK08278 7..277 CDD:181349 69/259 (27%)
SCP2 317..406 CDD:280250
Bdh2NP_001165526.1 PRK06138 12..254 CDD:235712 70/261 (27%)
DHRS6_like_SDR_c 15..255 CDD:187626 68/258 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.