DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and Hsd17b14

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_079606.3 Gene:Hsd17b14 / 66065 MGIID:1913315 Length:273 Species:Mus musculus


Alignment Length:274 Identity:66/274 - (24%)
Similarity:111/274 - (40%) Gaps:56/274 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KLAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEKAGGKAYPC 70
            :.:|:.:.:||.|||||..|.......||.:|...|                   ::|||:|...
Mouse     6 RYSGKVVVVTGGSRGIGAAIVRAFVDSGAQVVFCDK-------------------DEAGGRALEQ 51

  Fly    71 VV--------DVRDEQQVRSAVEAAVAKFGGIDIVINNASAISLTNTP-DTDMKRYDLMHNINTR 126
            .:        ||..|:.:::.|...:::||.:|.|:|||........| :|..:.:..:..:|..
Mouse    52 ELSGTVFIPGDVTQERDLQTLVSETLSRFGHLDCVVNNAGYHPPAQLPEETSAQGFRQLLEVNLL 116

  Fly   127 GTFLVSKVCLPYLKKSNHAHILNISPPLSMKPKWFGPHVA--YTMAKYGMSMCVLGMAAEFKDEG 189
            ||:.:.|:.||:|:|| ..:|:|||..:..    .|...|  |...|..::.....:|.:....|
Mouse   117 GTYTLIKLALPHLRKS-RGNIINISSLVGA----IGQSQALTYVATKGAVTAMTKALALDESRHG 176

  Fly   190 ISVNA---------LWPRTAIHTA-----AIEMLTGPDSAKWSRKPEIMADAAYAILTREPRQST 240
            :.||.         ||...|..|:     .:|........:..:..|:.|.|.:  |..|....|
Mouse   177 VRVNCISPGNIWTPLWEELAASTSDPRATILEGTLAQPLGRMGQPAEVAAAAVF--LASEATFCT 239

  Fly   241 GQFFVDDEVLESAG 254
            |.     |:|.:.|
Mouse   240 GL-----ELLVTGG 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 63/263 (24%)
PRK08278 7..277 CDD:181349 66/273 (24%)
SCP2 317..406 CDD:280250
Hsd17b14NP_079606.3 NADB_Rossmann 1..256 CDD:304358 66/274 (24%)
fabG 8..251 CDD:235546 66/272 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.