DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and BDH2

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:XP_006714337.1 Gene:BDH2 / 56898 HGNCID:32389 Length:259 Species:Homo sapiens


Alignment Length:286 Identity:69/286 - (24%)
Similarity:116/286 - (40%) Gaps:74/286 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GKLAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEKAGGKAYP 69
            |:|.|:.:.:|.|::|||:..||..||:||. |:|....|          |..:|:||     ||
Human     2 GRLDGKVIILTAAAQGIGQAAALAFAREGAK-VIATDINE----------SKLQELEK-----YP 50

  Fly    70 ----CVVDVRDEQQV---RSAVEAAVAKFGGIDIVINNASAISLTNTPDTDMKRYDLMHNINTRG 127
                .|:||..::|:   .:.||.       :|::.|.|..:......|.:.|.:|...|:|.|.
Human    51 GIQTRVLDVTKKKQIDQFANEVER-------LDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRS 108

  Fly   128 TFLVSKVCLPYLKKSNHAHILNIS------------------PPLSMKPKWFGPHVAYTMAKYGM 174
            .:|:.|..||.:......:|:|:|                  |.|.:..:     ..|:..|..:
Human   109 MYLMIKAFLPKMLAQKSGNIINMSSVASSVKVMATDDEKLRLPMLRVVNR-----CVYSTTKAAV 168

  Fly   175 SMCVLGMAAEFKDEGISVNALWPRTAIHTAAIEMLTGPDSAKWSRKPEIMADAAYAILTREPRQS 239
            ......:||:|..:||..|.:.|.|....:..|.:....:.:.:|...:            .||.
Human   169 IGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARGNPEEARNDFL------------KRQK 221

  Fly   240 TGQFFVDDEVL---------ESAGIT 256
            ||:|...:|:.         |||.:|
Human   222 TGRFATAEEIAMLCVYLASDESAYVT 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 64/264 (24%)
PRK08278 7..277 CDD:181349 68/284 (24%)
SCP2 317..406 CDD:280250
BDH2XP_006714337.1 DHRS6_like_SDR_c 5..259 CDD:187626 67/283 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.