DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and stoml1

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001103502.1 Gene:stoml1 / 563294 ZFINID:ZDB-GENE-070209-241 Length:410 Species:Danio rerio


Alignment Length:110 Identity:39/110 - (35%)
Similarity:66/110 - (60%) Gaps:2/110 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 IPQLFRKIESLLSPEIVSKTQAVFQFNI--SGAEQGTWFLDLKNGSGSCGAGTPTAAPDATLTMN 366
            :.:|...:.|:||.|:|.:..|.|.|:|  :..:..::::||..|.|:||||.....||.:|.|:
Zfish   301 VNELIETVRSVLSEELVHQVGACFHFHITTNSGQTSSYYVDLTQGRGACGAGVLQREPDVSLCMS 365

  Fly   367 SKNFFDMFSGKLKAAPAYMTGKLKISGDFQKALKLEKLMKALKSK 411
            .::...||.|.|:...||.:|:|::.||...|:||..|:|.||::
Zfish   366 EQDLLAMFQGSLQPFAAYSSGRLRVQGDLNTAMKLNTLIKLLKAR 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959
PRK08278 7..277 CDD:181349
SCP2 317..406 CDD:280250 32/90 (36%)
stoml1NP_001103502.1 PHB 94..232 CDD:214581
SPFH_SLP-1 109..239 CDD:259814
SCP2 301..405 CDD:280250 36/103 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4170
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.