DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and PECR

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_060911.2 Gene:PECR / 55825 HGNCID:18281 Length:303 Species:Homo sapiens


Alignment Length:259 Identity:60/259 - (23%)
Similarity:105/259 - (40%) Gaps:36/259 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GKLAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIE-----KAG 64
            |.|.|:...:||.:.||||.|..:....|:|:|:|::..|       .:.|||:|::     ...
Human    14 GLLQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRKLE-------RLKSAADELQANLPPTKQ 71

  Fly    65 GKAYPCVVDVRDEQQVRSAVEAAVAKFGGIDIVINNASAISLTNTPDTDMKRYDLMHNINTRGTF 129
            .:..|...::|:|::|.:.|::.:..||.|:.::||.....|:.......|.:..:...|..|||
Human    72 ARVIPIQCNIRNEEEVNNLVKSTLDTFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTF 136

  Fly   130 LVSKVCLPYLKKSNHAHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFKDEGISVNA 194
            .:.|.......|.:...|:||..|..   ..|...|....|:.|:......:|.|:...||.:|.
Human   137 YMCKAVYSSWMKEHGGSIVNIIVPTK---AGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINC 198

  Fly   195 LWPRTAIHTAAIEMLTGPDSAKWSRK----------------PEIMADAAYAILTREPRQSTGQ 242
            :.|.......|:|     :...|.:.                ||.::.....:|:......|||
Human   199 VAPGVIYSQTAVE-----NYGSWGQSFFEGSFQKIPAKRIGVPEEVSSVVCFLLSPAASFITGQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 60/259 (23%)
PRK08278 7..277 CDD:181349 59/257 (23%)
SCP2 317..406 CDD:280250
PECRNP_060911.2 TER_DECR_SDR_a 16..267 CDD:187627 59/257 (23%)
Microbody targeting signal 301..303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.