DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and zgc:113054

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001013468.1 Gene:zgc:113054 / 541322 ZFINID:ZDB-GENE-050320-9 Length:551 Species:Danio rerio


Alignment Length:220 Identity:53/220 - (24%)
Similarity:95/220 - (43%) Gaps:23/220 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KLAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEKAGGKAYPC 70
            :|.|:..::|||.:|||:..|......||.:.:.....       |.....|.|:...|..:...
Zfish   303 RLDGKVAYVTGAGQGIGRAFAHALGEAGAKVAIIDMDR-------GKAEDVAHELTLKGISSMAV 360

  Fly    71 VVDVRDEQQVRSAVEAAVAKFGGIDIVINNASAISLTNTPDTDMKRYDLMHNINTRGTFLVSKVC 135
            |.|:.....|:..::..|.|:|.:.|..|||.....:.:.:|.::.:|...|:|.||||:..:..
Zfish   361 VADISKPDDVQKMIDDIVTKWGTLHIACNNAGINKNSASEETSLEEWDQTFNVNLRGTFMCCQAA 425

  Fly   136 LPYLKKSNHAHILNISPPLSMKPKWFGPH----VAYTMAKYGMSMCVLGMAAEFKDEGISVNALW 196
            ...:.|..:..|:|.:...|:    ..||    ::|..:|.|:......:..|:.|.|:.||.:.
Zfish   426 GRVMLKQGYGKIINTASMASL----IVPHPQKQLSYNTSKAGVVKLTQTLGTEWIDRGVRVNCIS 486

  Fly   197 P----RTAIHTAAIEMLTGPDSAKW 217
            |    ...||:.::|.|.    .:|
Zfish   487 PGIVDTPLIHSESLEPLV----QRW 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 53/220 (24%)
PRK08278 7..277 CDD:181349 53/219 (24%)
SCP2 317..406 CDD:280250
zgc:113054NP_001013468.1 YrrM 40..270 CDD:226607
AdoMet_MTases 59..270 CDD:302624
NADB_Rossmann 299..548 CDD:304358 53/220 (24%)
fabG 303..550 CDD:235546 53/220 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.