DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and Dhrs1

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_081095.2 Gene:Dhrs1 / 52585 MGIID:1196314 Length:313 Species:Mus musculus


Alignment Length:274 Identity:63/274 - (22%)
Similarity:118/274 - (43%) Gaps:33/274 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEKAGGKAYPCV 71
            :.|:...:||||||||:.|||:..:.||.:.:..:..:       |:.:.|:|.:..||:..|.|
Mouse     5 MKGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLD-------TLRATAQEAQSLGGRCVPVV 62

  Fly    72 VDVRDEQQVRSAVEAA-VAKFGGIDIVINNASA-----ISLTNTP--DTDMKRYDLMHNINTRGT 128
            .|...|.:|:|..|.. ..:.|.:|:::|||.|     ::.||..  :.....:|.::|:..||.
Mouse    63 CDSSQESEVKSLFEQVDREQKGRLDVLVNNAYAGVQAILNTTNKSFWEVPASIWDDINNVGLRGH 127

  Fly   129 FLVSKVCLPYLKKSNHAHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFKDEGISVN 193
            :|.|......:..:....|:.:|.|..::..:   :|.|.:.|..........|.|.:..|:|..
Mouse   128 YLCSVYGARLMVPAGKGLIVIVSSPGGLQHMF---NVPYGVGKAACDRLAADCAHELRRHGVSYV 189

  Fly   194 ALWPRTAIHTAAIEMLTGPDSAK------------WSRKPEIMADAAYAILTREPR--QSTGQFF 244
            :|||.........|.:...|:.:            .:..||:......|:.| :|.  ..:|:..
Mouse   190 SLWPGLVQTEMVKEFMAKEDTPEDPLFKKMKPDFSSAESPEMSGKCVVALAT-DPNILNLSGKVL 253

  Fly   245 VDDEVLESAGITDL 258
            ...::....|:.|:
Mouse   254 PSCDLARRYGLKDI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 61/259 (24%)
PRK08278 7..277 CDD:181349 63/274 (23%)
SCP2 317..406 CDD:280250
Dhrs1NP_081095.2 DHRS1-like_SDR_c 5..271 CDD:187664 63/274 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.