DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and HSD17B14

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_057330.2 Gene:HSD17B14 / 51171 HGNCID:23238 Length:270 Species:Homo sapiens


Alignment Length:284 Identity:72/284 - (25%)
Similarity:114/284 - (40%) Gaps:55/284 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TG-KLAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEP----HPKLPGTIYSAAEEIEKA 63
            || :.||:.:.:||..||||..|.......||.:|:..|....    ..:|||.::         
Human     3 TGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVF--------- 58

  Fly    64 GGKAYPCVVDVRDEQQVRSAVEAAVAKFGGIDIVINNASAISLTNTP-DTDMKRYDLMHNINTRG 127
                  .:.||..|..|::.|...:.:||.:|.|:|||........| :|..:.:..:..:|..|
Human    59 ------ILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLG 117

  Fly   128 TFLVSKVCLPYLKKSNHAHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFKDEGISV 192
            |:.::|:.||||:|| ..:::|||..:....:  ...|.|...|..::.....:|.:....|:.|
Human   118 TYTLTKLALPYLRKS-QGNVINISSLVGAIGQ--AQAVPYVATKGAVTAMTKALALDESPYGVRV 179

  Fly   193 NA---------LW---------PRTAIHTAAIEMLTGPDSAKWSRKPEIMADAAYAILTREPRQS 239
            |.         ||         ||..|...   ||..| ..:..:..|:.|.|.:  |..|....
Human   180 NCISPGNIWTPLWEELAALMPDPRATIREG---MLAQP-LGRMGQPAEVGAAAVF--LASEANFC 238

  Fly   240 TGQFFVDDEVLESAGITDLTEYAC 263
            ||     .|:|.:.|..  ..|.|
Human   239 TG-----IELLVTGGAE--LGYGC 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 66/263 (25%)
PRK08278 7..277 CDD:181349 70/280 (25%)
SCP2 317..406 CDD:280250
HSD17B14NP_057330.2 RDH_SDR_c 1..256 CDD:187638 72/284 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.