DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and zgc:101858

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001005597.1 Gene:zgc:101858 / 449555 ZFINID:ZDB-GENE-040927-13 Length:265 Species:Danio rerio


Alignment Length:244 Identity:70/244 - (28%)
Similarity:121/244 - (49%) Gaps:33/244 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GKLAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEKAGGKAYP 69
            |.|..:...|||||.|||...||..|:.||.:.:..:..|       .:...|:|.| |.|.|.|
Zfish    10 GSLNDKVTLITGASSGIGAGTALLFAKLGARLALNGRDVE-------NLTKVAKECE-ACGAAKP 66

  Fly    70 CVV--DVRDEQQVRSAVEAAVAKFGGIDIVINNASAISLTNTPDTDMKRYDLMHNINTRGTFLVS 132
            .:|  |:.||:.||..||..:|.||.:|:::|:|..:::.:...|||.:||.:.::|.|..:.::
Zfish    67 LLVAGDLTDEETVRRTVEEVIAHFGRLDVLVNSAGILAMGSIETTDMAQYDKVMSVNVRSIYHLT 131

  Fly   133 KVCLPYLKKSNHAHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFKDEGISVNALWP 197
            .:|:|:|.|:. ..|:|:|.....:.  |...:||.|:|..:......:|.|...:.:.||::.|
Zfish   132 HLCVPHLIKTK-GSIVNVSSVNGQRS--FPGVLAYCMSKSAIDQFTRCVALELASKQVRVNSVCP 193

  Fly   198 R---TAIHTAAIEMLTGPDSAKWSR------------KPEIMADAAYAI 231
            .   |.:|..|     |.|..::::            :|..:.:.|:||
Zfish   194 GVIITEVHKRA-----GLDEEQYAQFIEKCKVTHALGRPGEVDEVAHAI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 70/244 (29%)
PRK08278 7..277 CDD:181349 69/242 (29%)
SCP2 317..406 CDD:280250
zgc:101858NP_001005597.1 fabG 11..260 CDD:235546 69/243 (28%)
SDR_c11 12..262 CDD:187622 69/242 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.