DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and MGC79752

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001005019.1 Gene:MGC79752 / 448527 XenbaseID:XB-GENE-5820599 Length:264 Species:Xenopus tropicalis


Alignment Length:204 Identity:61/204 - (29%)
Similarity:103/204 - (50%) Gaps:16/204 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEKAGGKAYPCV 71
            |..:...:||||.|||...||..||.||.:.:..:..|   ||..|    |:..|:..|.. |.:
 Frog    11 LKDKVCLVTGASSGIGAGTALLFARLGARLALNGRNEE---KLQET----AQGCEQFSGMK-PLL 67

  Fly    72 V--DVRDEQQVRSAVEAAVAKFGGIDIVINNASAISLTNTPDTDMKRYDLMHNINTRGTFLVSKV 134
            |  |:.||:.||..||..||.||.:|:::|:...:::....:|.::.:|.:.|:|.|..|.::.:
 Frog    68 VPGDLTDEESVRKIVEQTVAHFGRLDVLVNSGGILAMGTVENTSLQDFDRVMNVNVRSLFYLTHL 132

  Fly   135 CLPYLKKSNHAHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFKDEGISVNALWPR- 198
            .:|:|.::. .:|:|:|.....:.  |...:||.|:|..:.......|.|...:.:.|||:.|. 
 Frog   133 AVPHLIQTK-GNIVNVSSVNGQRS--FPGVLAYCMSKSAVDQLTRCAALELAPKQVRVNAVCPGV 194

  Fly   199 --TAIHTAA 205
              |.:|..|
 Frog   195 IITDVHRRA 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 61/204 (30%)
PRK08278 7..277 CDD:181349 61/204 (30%)
SCP2 317..406 CDD:280250
MGC79752NP_001005019.1 SDR_c11 11..261 CDD:187622 61/204 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.