DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and ScpX

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_524715.2 Gene:ScpX / 44183 FlyBaseID:FBgn0015808 Length:544 Species:Drosophila melanogaster


Alignment Length:381 Identity:80/381 - (20%)
Similarity:128/381 - (33%) Gaps:121/381 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 RSAVEAAVAKFGGIDIVINNASAI---SLTNTPDTDMKRYDLMHNINTRGTFLVSKVCLPYLKKS 142
            |..:|....:..|:::..:.||..   ||.....|||.|      :.|:..|..|..      |.
  Fly   236 RHGLEKQAVEIVGMEMASDPASTFADKSLMKIAGTDMTR------LATQRLFAKSGY------KP 288

  Fly   143 NHAHILNISPPLSMKPKWFGPHVAYTMAKY-GMSMCVLGMAAEFKDEGISVNALWPRTAIHTAAI 206
            ....::.:....|          |..:..| .:.:|..|.|.||.|.|                 
  Fly   289 QDVQVVELHDCFS----------ANELITYEALGLCGEGNAGEFIDAG----------------- 326

  Fly   207 EMLTGPDSAKWSRKPEIMADAAYAILTREPRQSTGQFFVD--------DEVLESAGITDLTEYAC 263
                               |..|.          |:|.|:        ...|.:.|:....| .|
  Fly   327 -------------------DNTYG----------GKFVVNPSGGLISKGHPLGATGLAQCAE-LC 361

  Fly   264 F--RENADKLMVD-----------------FFVEEKGAP-----VENEAAAEDAAAPASGGDVKI 304
            :  |..|:|..|.                 ..:...|.|     |.|..||..||....|  .|:
  Fly   362 WQLRGLAEKRQVPNAQLALQHNLGLGGAVVVALYRLGFPAANSVVRNLTAAGKAATSEDG--FKV 424

  Fly   305 PQLFRKIESLLSPE---IVSKTQAVFQFNIS---GAEQGTWFLDLKNGSGSCGAGTPTAAPDATL 363
            ..|.:.:|..:..:   ::.|.:|::.|.::   ..:.|.|.:|.|.|.|.. ....|...|.|.
  Fly   425 APLLKLLEQAMQEDKDNLIEKVRAIYGFKVNNGPNGQTGFWVIDAKQGKGKI-IFNGTQKCDVTF 488

  Fly   364 TMNSKNFFDMFSGKLKAAPAYMTGKLKISGDFQKALKLEKLMKA-------LKSKL 412
            .::..:.|::.:|||....|:..||:||.|:...|:||..|.::       |:|||
  Fly   489 IISDDDVFELLTGKLPPQKAFFQGKIKIQGNMGFAMKLMDLQRSAQGRIEELRSKL 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 29/167 (17%)
PRK08278 7..277 CDD:181349 38/226 (17%)
SCP2 317..406 CDD:280250 26/94 (28%)
ScpXNP_524715.2 PRK08256 5..396 CDD:181327 38/228 (17%)
SCP-x_thiolase 9..395 CDD:238425 38/227 (17%)
SCP2 429..529 CDD:280250 26/100 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4170
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.