DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and decr1

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001002444.2 Gene:decr1 / 436717 ZFINID:ZDB-GENE-040718-142 Length:333 Species:Danio rerio


Alignment Length:202 Identity:54/202 - (26%)
Similarity:90/202 - (44%) Gaps:17/202 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MINTGKLAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEI-EKAG 64
            |:..|....:..||||...|:||.:....:..||..|:|:::.:       .:...|:|| ::.|
Zfish    49 MLLPGTFKNKVAFITGGGTGLGKAMTTTLSSLGAECVIASRSLD-------VLQKTADEISQQTG 106

  Fly    65 GKAYPCVVDVRDEQQVRSAVEAAVAKFGGIDIVINNASA--ISLTN--TPDTDMKRYDLMHNINT 125
            .|.:....:|||...|.:||:..|...|..|:|||||:.  ||.:.  :|:......:::.|.|.
Zfish   107 NKVHAIRCNVRDPASVEAAVDQLVKDVGLPDVVINNAAGNFISPSEKLSPNAWKTITEIVLNGNA 171

  Fly   126 RGTFLVSKVCLPYLKKSNHAHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFKDEGI 190
            ..|..:.|   ..:|....|..|:|:...:.....|  .|....||.|:......:|||:...|:
Zfish   172 YVTLDIGK---RLIKAEKGAAFLSITTIYAESGSGF--VVPSAAAKSGVEKLCTSLAAEWSRYGM 231

  Fly   191 SVNALWP 197
            ..|.:.|
Zfish   232 RFNVIQP 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 53/198 (27%)
PRK08278 7..277 CDD:181349 52/196 (27%)
SCP2 317..406 CDD:280250
decr1NP_001002444.2 TER_DECR_SDR_a 55..301 CDD:187627 52/196 (27%)
PRK07677 57..302 CDD:181077 52/194 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.