Sequence 1: | NP_651578.1 | Gene: | CG5590 / 43325 | FlyBaseID: | FBgn0039537 | Length: | 412 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002444.2 | Gene: | decr1 / 436717 | ZFINID: | ZDB-GENE-040718-142 | Length: | 333 | Species: | Danio rerio |
Alignment Length: | 202 | Identity: | 54/202 - (26%) |
---|---|---|---|
Similarity: | 90/202 - (44%) | Gaps: | 17/202 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MINTGKLAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEI-EKAG 64
Fly 65 GKAYPCVVDVRDEQQVRSAVEAAVAKFGGIDIVINNASA--ISLTN--TPDTDMKRYDLMHNINT 125
Fly 126 RGTFLVSKVCLPYLKKSNHAHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFKDEGI 190
Fly 191 SVNALWP 197 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5590 | NP_651578.1 | FabG | 5..245 | CDD:223959 | 53/198 (27%) |
PRK08278 | 7..277 | CDD:181349 | 52/196 (27%) | ||
SCP2 | 317..406 | CDD:280250 | |||
decr1 | NP_001002444.2 | TER_DECR_SDR_a | 55..301 | CDD:187627 | 52/196 (27%) |
PRK07677 | 57..302 | CDD:181077 | 52/194 (27%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0725 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |