DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and F12E12.11

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001040762.2 Gene:F12E12.11 / 4363044 WormBaseID:WBGene00044811 Length:280 Species:Caenorhabditis elegans


Alignment Length:224 Identity:59/224 - (26%)
Similarity:94/224 - (41%) Gaps:31/224 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KLAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEKAGGKA--- 67
            :.:|:...:||:|.|||:..||..|:.||.:.:..:.||       .:....:.|.|:|..|   
 Worm     3 RFSGKVALVTGSSNGIGRAAALLFAQQGAKVTITGRNAE-------RLEETRQAILKSGVPAENV 60

  Fly    68 YPCVVDVRDEQQVRSAVEAAVAKFGGIDIVINNASAISLTNTP------DTDMKRYDLMHNINTR 126
            .....|:..:|.....:...:.|||.:||::|||.|  ..|.|      |..::.:|....||.|
 Worm    61 LAIAADLATDQGQTDLINGTLQKFGRLDILVNNAGA--AVNDPQGRMGIDQQIEDFDKTFQINMR 123

  Fly   127 GTFLVSKVCLPYLKKSNHAHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVL-----GMAAEFK 186
            ....:.:....:|.|:. ..|:|:|....      |||....|..||||...|     ..|....
 Worm   124 SVVTLVQKAKEHLIKTK-GEIINVSSIGG------GPHAQPDMMYYGMSKAALDQFTRSTAITLI 181

  Fly   187 DEGISVNALWPRTAIHTAAIEMLTGPDSA 215
            ..|:.||::.| ..::|...|.:..|..|
 Worm   182 QHGVRVNSVSP-GGVYTGFGEAMGFPPGA 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 59/224 (26%)
PRK08278 7..277 CDD:181349 59/223 (26%)
SCP2 317..406 CDD:280250
F12E12.11NP_001040762.2 fabG 3..261 CDD:235975 59/224 (26%)
NADB_Rossmann 4..265 CDD:304358 59/223 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.