DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and CG7601

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_651717.1 Gene:CG7601 / 43502 FlyBaseID:FBgn0027583 Length:326 Species:Drosophila melanogaster


Alignment Length:260 Identity:67/260 - (25%)
Similarity:114/260 - (43%) Gaps:54/260 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KLAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEKAG------ 64
            :|.|:.:.|||||.|:|:.:|....|.|..:::||:              ..:|:|:..      
  Fly    50 QLPGKVVLITGASSGLGESLAHVFYRAGCRVILAAR--------------RTQELERVKKDLLAL 100

  Fly    65 --GKAYPCVV---DVRDEQQVRSAVEAAVAKFGGIDIVINNASAISL-----TNTPDTDMKRYDL 119
              ..|||..|   |:.:...:...|...:|.:..:||:||| ..||:     :...|.|:|    
  Fly   101 DVDPAYPPTVLPLDLAELNSIPEFVTRVLAVYNQVDILINN-GGISVRADVASTAVDVDLK---- 160

  Fly   120 MHNINTRGTFLVSKVCLPYLKKSNHAHILNISPPLSMKPKWFGP-HVAYTMAKYGMSMCVLGMAA 183
            :..:|..|:..::|..||.:.|....||..||   |::.|:..| ..||:.:|:.|......:.|
  Fly   161 VMVVNYFGSVALTKALLPSMVKRGSGHICFIS---SVQGKFAIPQRAAYSASKHAMQAFADSLRA 222

  Fly   184 EFKDEGISVNALWP---RTAIHTAAIEMLTGPDS---------AKWSRKPEIMADAAYAILTREP 236
            |..::.|:|:.:.|   ||.:   ::..|||..|         ||.....::.......||.:||
  Fly   223 EVANKNINVSCVSPGYIRTQL---SLNALTGSGSSYGKVDETTAKGMSPDKLAERILQCILRKEP 284

  Fly   237  236
              Fly   285  284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 67/260 (26%)
PRK08278 7..277 CDD:181349 67/259 (26%)
SCP2 317..406 CDD:280250
CG7601NP_651717.1 11beta-HSD1_like_SDR_c 51..310 CDD:187593 67/259 (26%)
PRK06181 53..314 CDD:235726 66/257 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435191
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.