DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and CG13833

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster


Alignment Length:212 Identity:59/212 - (27%)
Similarity:92/212 - (43%) Gaps:21/212 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAGRTLFITGASRGIGKEIALKAARDGANIVVA---AKTAEPHPKLPGTIYSAAEEIEKAGGKAY 68
            :||....:|||..|:|:.|:|:.|:.|.:|.|.   ...||...|       ..::|.|...|||
  Fly    50 IAGEVAVVTGAGHGLGRAISLELAKKGCHIAVVDINVSGAEDTVK-------QIQDIYKVRAKAY 107

  Fly    69 PC-VVDVRDEQQVRSAVEAAVAKFGGIDIVINNASAISLTNTPDTDMKRYDLMHNINTRGTFLVS 132
            .. |.:..|..::.|.|   |.:.|.:.:::|||..:...|..:.|.....||.|:|....|...
  Fly   108 KANVTNYDDLVELNSKV---VEEMGPVTVLVNNAGVMMHRNMFNPDPADVQLMINVNLTSHFWTK 169

  Fly   133 KVCLPYLKKSNHAHILNISPPLSMKPKWFGPHVA-YTMAKYG--MSMCVLGMAAEFKDE-GISVN 193
            .|.||.:|:.....|:.||....:.|.   |:.| ||..|.|  ..|..|.|..:.::: .|.|.
  Fly   170 LVFLPKMKELRKGFIVTISSLAGVFPL---PYSATYTTTKSGALAHMRTLRMELDLENQKDIHVT 231

  Fly   194 ALWPRTAIHTAAIEMLT 210
            .:.|......:.:..||
  Fly   232 TVLPSFLRTNSDVTQLT 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 59/212 (28%)
PRK08278 7..277 CDD:181349 59/212 (28%)
SCP2 317..406 CDD:280250
CG13833NP_651111.1 adh_short 53..241 CDD:278532 55/200 (28%)
NADB_Rossmann 54..297 CDD:304358 57/208 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1809
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.