DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsdl2 and euc

DIOPT Version :10

Sequence 1:NP_651578.1 Gene:Hsdl2 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001247188.1 Gene:euc / 42271 FlyBaseID:FBgn0038665 Length:112 Species:Drosophila melanogaster


Alignment Length:113 Identity:28/113 - (24%)
Similarity:50/113 - (44%) Gaps:19/113 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 VKIPQLFRKIESLLSPEIVSKTQAV--FQFNISGAE----QGTWF----LDLKNGSGSCGAGTPT 356
            :|..::..||.:.|.....::...|  ||||.:.|:    :...|    ||:..||.:       
  Fly     1 MKSDEIIEKIRNKLKESDPARRTVVNTFQFNFTDADGNLIKSMVFDFKALDIYEGSAT------- 58

  Fly   357 AAPDATLTMNSKNFFDMFSGKLKAAPAYMTGKLKISGDFQKALK-LEK 403
             :.||.:|::.::|:.:.:.:..........|.||.||.:...| |||
  Fly    59 -SVDAQVTISDEDFYLVGTKQKTFQEVLQQEKAKIDGDEEAINKMLEK 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsdl2NP_651578.1 PRK08278 7..277 CDD:181349
SCP2 306..408 CDD:442486 27/109 (25%)
eucNP_001247188.1 SCP2 12..95 CDD:460423 19/90 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.