DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and CG31549

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster


Alignment Length:264 Identity:70/264 - (26%)
Similarity:121/264 - (45%) Gaps:43/264 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEKAGGKAYPCVV-- 72
            :.:.:||||.|||...|:..|:.|..:|:..:..|   ||..|    |:.|..||| |.|..:  
  Fly     7 KVIIVTGASSGIGASAAVHLAKLGGLLVIVGRNEE---KLKET----ADNIVAAGG-ATPLELQA 63

  Fly    73 DVRDEQQVRSAVEAAVAKFGGIDIVINNASAISLTNTPDTDMKRYDLMHNINTRGTFLVSKVCLP 137
            |:..|.:|:..|.|.:||.|.||:::|||..:...:...|.::::|.:.|.|.|..:.::.:..|
  Fly    64 DMTKEAEVQQIVGATLAKHGRIDVLVNNAGILETGSIEATSLEQFDRLMNTNVRSLYQLTMLATP 128

  Fly   138 YLKKSNHAHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFKDEGISVNALWPR---T 199
            .|.|:. .:|:|:|....::.  |...:||.::|..:......:|.|...:|:.|||:.|.   |
  Fly   129 ELVKTK-GNIVNVSSVCGLRA--FPGVLAYNVSKAAVDQFTACIALELAPKGVRVNAVNPGVIVT 190

  Fly   200 AIHTAAIEMLTGPDSAKWSR------------KPEIMADAAYAILTREPRQSTGQFFVDDEVLES 252
            .||...     |.|...:::            :|..:.:.|.||          .|...|:...:
  Fly   191 DIHKRG-----GMDEETYAKFLEHCKITHALGRPGDVKEVAAAI----------AFLASDQASFT 240

  Fly   253 AGIT 256
            .||:
  Fly   241 TGIS 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 67/251 (27%)
PRK08278 7..277 CDD:181349 70/264 (27%)
SCP2 317..406 CDD:280250
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 70/264 (27%)
fabG 4..251 CDD:235975 70/264 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435111
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.