DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and dhrs4

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_956861.2 Gene:dhrs4 / 393539 ZFINID:ZDB-GENE-040426-1498 Length:276 Species:Danio rerio


Alignment Length:257 Identity:58/257 - (22%)
Similarity:113/257 - (43%) Gaps:41/257 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEKAG-----GK 66
            |:|:...:|.::.|||...|....:.||::||:::......|....:.|  :.|:..|     ||
Zfish    28 LSGKVAIVTASTDGIGLAAAEALGQRGAHVVVSSRRQTNVDKAVSLLRS--KNIKVIGTTCNVGK 90

  Fly    67 AYPCVVDVRDEQQVRSAVEAAVAKFGGIDIVINNASAIS--LTNTPDTDMKRYDLMHNINTRGTF 129
            |       .|.:::   :...|.:.||:||:::|| |::  ..|..|:..:.:|.:..:|.:.:|
Zfish    91 A-------EDREKL---INMTVEQCGGVDILVSNA-AVNPFFGNILDSTEEVWDKILGVNVKASF 144

  Fly   130 LVSKVCLPYLKKSNHAHILNISPPLSMKP-KWFGPHVAYTMAKYGMSMCVLGMAAEFKDEGISVN 193
            |::|:.:|:::|.....::.:|.....:| ...||   |:::|..:......:|.|.....|.||
Zfish   145 LLTKMVVPHIEKRGGGSVVIVSSVAGYQPMPALGP---YSVSKTALLGLTRALAPELAQSNIRVN 206

  Fly   194 -------------ALWPRTAIHTAAIEMLTGPDSAKWSRKPEIMADAAYAILTREPRQSTGQ 242
                         |||....:    :|......|.|...:||.:......:.:.|....||:
Zfish   207 CVAPGIIKTRFSSALWENEGV----LEEFLKQTSIKRLGQPEEIGGVIAFLCSDEASYITGE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 58/257 (23%)
PRK08278 7..277 CDD:181349 58/257 (23%)
SCP2 317..406 CDD:280250
dhrs4NP_956861.2 CR_SDR_c 21..276 CDD:187641 58/257 (23%)
fabG 28..272 CDD:235975 58/257 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.