DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5590 and CG10672

DIOPT Version :9

Sequence 1:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster


Alignment Length:266 Identity:65/266 - (24%)
Similarity:124/266 - (46%) Gaps:34/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KLAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEKAGGKAYPC 70
            :|||:...:|.::.|||..||.:.|.|||.:|::::..:       .:.||..|:.|.....:..
  Fly    68 RLAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQK-------NVDSALAELRKLNLNVHGL 125

  Fly    71 VVDVRDEQQVRSAVEAAVAKFGGIDIVINNASAISLTNTP-----DTDMKRYDLMHNINTRGTFL 130
            ...|.:.:..:...|..::|||.::|:::||:    ||..     :.|.|.:|.:.::|.:.::|
  Fly   126 KCHVSEPEDRKQLFEETISKFGKLNILVSNAA----TNPAVGGVLECDEKVWDKIFDVNVKSSYL 186

  Fly   131 VSKVCLPYLKKSNHAHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFKDEGISVNAL 195
            ::|..||.|::..::.|:.:|.......  |....||:::|..:.......|.:...|||.||.|
  Fly   187 LAKEALPLLRQQKNSSIVFVSSIAGYDA--FELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNCL 249

  Fly   196 WP---RTAIHTAAIEMLTGPDSAKWSRKP-------EIMADAAYAILTREPRQSTGQFFVDDEVL 250
            .|   ||....|..|..:..::| .|:.|       |.||.....:::.:....||     :.::
  Fly   250 APGVIRTKFSKALYENESANEAA-LSKIPMGRLGTSEEMAGVVSFLVSEDAGYITG-----ESIV 308

  Fly   251 ESAGIT 256
            ...|:|
  Fly   309 AGGGMT 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5590NP_651578.1 FabG 5..245 CDD:223959 63/253 (25%)
PRK08278 7..277 CDD:181349 65/265 (25%)
SCP2 317..406 CDD:280250
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 65/266 (24%)
fabG 67..316 CDD:235975 65/266 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435192
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.